[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF69863.1"

            "inner membrane transport protein YnfM"
            ""

OrgPattern -------------------------------------------------------------------- 111-11-1111121211--------1----------1111-------1----111111------1-1111------------------11---------------1--1---------------------------111--------------------------------------------1-1-----1-2-------------1---11-2--11-111--------21---------------1--11----------------------------------1---------------------------------------1-----------------------1----------------------1----------11-----1------112--1-111-11111111----1--1111111-----------------11111111111---------------------------------------1111--133231211111111111112111-1----111-------11---------21----------11-----1-----1----1-11----12211-------------------------1---1111----1-1111111111111111111111------111---112121111111111111-11111111111111111111211111121112122222121121--1---11-111-111-1111---------------111---------------22222111111-22122112112112111----------111111111111111111111111------1-------------------------------------------------------- ---------------11-------------------------------11------------------------------------------1-----------------------------------------------------------------------------------------------------1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSRTTILDDATASDIDEQRHSQPVQFIKRGTAPFMRVTLALFSAGLATFALLYCVQPILP:Sequence : ============================================:RP:SCP|17->414|1pw4A|1e-08|11.1|398/434|f.38.1.1 :============================================================:BL:SWS|1->417|YNFM_ECOLI|0.0|83.5|417/417 : $$$$$$:RP:PFM|55->258|PF07690|1e-08|24.5|204/347|MFS_1 61: . . . * . .: 120 :VLSQEFGVSPASSSVSLSISTAMLAIGLLFTGPLSDAIGRKPVMVTALLLASCCTLLSTM:Sequence : XXXXXXXXXXXX :SEG|69->80|spasssvslsis : XXXXXXXXXXXXXX :SEG|106->119|talllascctllst : ################# :PROS|91->107|PS00216|SUGAR_TRANSPORT_1|PDOC00190| :============================================================:RP:SCP|17->414|1pw4A|1e-08|11.1|398/434|f.38.1.1 :============================================================:BL:SWS|1->417|YNFM_ECOLI|0.0|83.5|417/417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|55->258|PF07690|1e-08|24.5|204/347|MFS_1 121: . . + . . .: 180 :MTSWHGILIMRALIGLSLSGVAAVGMTYLSEEIHPSFVAFSMGLYISGNSIGGMSGRLLS:Sequence :============================================================:RP:SCP|17->414|1pw4A|1e-08|11.1|398/434|f.38.1.1 :============================================================:BL:SWS|1->417|YNFM_ECOLI|0.0|83.5|417/417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|55->258|PF07690|1e-08|24.5|204/347|MFS_1 181: . * . . . .: 240 :GVMTDFFNWRIALAAIGCFALASALMFWKILPASQHFRPTSLRPKTLFINFRLHWRDRGL:Sequence :============================================================:RP:SCP|17->414|1pw4A|1e-08|11.1|398/434|f.38.1.1 :============================================================:BL:SWS|1->417|YNFM_ECOLI|0.0|83.5|417/417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|55->258|PF07690|1e-08|24.5|204/347|MFS_1 241: + . . . . *: 300 :PLLFAEGFLLMGAFVTLFNYIGYRLMLSPWELSQAVVGLLSVAYLTGTWSSPKAGAMTSR:Sequence :============================================================:RP:SCP|17->414|1pw4A|1e-08|11.1|398/434|f.38.1.1 :============================================================:BL:SWS|1->417|YNFM_ECOLI|0.0|83.5|417/417 :$$$$$$$$$$$$$$$$$$ :RP:PFM|55->258|PF07690|1e-08|24.5|204/347|MFS_1 301: . . . . + .: 360 :YGRGPVMLFSTAVMLGGLLLTLFTSLWLIFAGMLLFSAGFFAAHSVASSWIGPRARRAKG:Sequence : XXXXXXXXXXXXXX :SEG|315->328|lggllltlftslwl :============================================================:RP:SCP|17->414|1pw4A|1e-08|11.1|398/434|f.38.1.1 :============================================================:BL:SWS|1->417|YNFM_ECOLI|0.0|83.5|417/417 361: . . . * . .: 420 :QASSLYLFSYYLGSSIAGTLGGVFWHSYGWNGVGGFIALMLVLAILVGTRLHHRLHA :Sequence : XXXXXXXXXXXXX :SEG|363->375|sslylfsyylgss :====================================================== :RP:SCP|17->414|1pw4A|1e-08|11.1|398/434|f.38.1.1 :========================================================= :BL:SWS|1->417|YNFM_ECOLI|0.0|83.5|417/417