[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF69863.1 sent8 ACF69863.1 "inner membrane transport protein YnfM"
MSRTTILDDATASDIDEQRHSQPVQFIKRGTAPFMRVTLALFSAGLATFALLYCVQPILP
VLSQEFGVSPASSSVSLSISTAMLAIGLLFTGPLSDAIGRKPVMVTALLLASCCTLLSTM
MTSWHGILIMRALIGLSLSGVAAVGMTYLSEEIHPSFVAFSMGLYISGNSIGGMSGRLLS
GVMTDFFNWRIALAAIGCFALASALMFWKILPASQHFRPTSLRPKTLFINFRLHWRDRGL
PLLFAEGFLLMGAFVTLFNYIGYRLMLSPWELSQAVVGLLSVAYLTGTWSSPKAGAMTSR
YGRGPVMLFSTAVMLGGLLLTLFTSLWLIFAGMLLFSAGFFAAHSVASSWIGPRARRAKG
QASSLYLFSYYLGSSIAGTLGGVFWHSYGWNGVGGFIALMLVLAILVGTRLHHRLHA
//