[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF69930.1"

            "transposase for"
T200_SALTY  "RecName: Full=Transposase for insertion sequence element IS200;"

OrgPattern --1---1--111--17--------1221--81-------------------BC-----1-1-12---- ---------------------2----------1------1--33----------------------11--2----------1-----1--------4------1----1------------------------2------------419-743E1----------5-16---------------19-------------5-------1248-----------21-------2----1--1-22---22-432-1------5--1--GG---1-----------22--212-----1--1---------------44322222-2--1------1--2-A122-2-A-32-3-2--321212--21----1-23----------------21---1---------------------------------4------------1---------------1--------------------------B-----------------------------------------------------------1--------------------1--6---4-----1-2-----------3-1-------------------1-2----------1------1-1---28-2-----24---1----9---3-----------------21K-1-211-1---1821-2216---------1--8B7--72---4-1R6R71---2------3*rm5***uF2E---------------------------------------------------------------------------S47447--------------------------------1--1--------------------------------3-312-2--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGDEKSLAHTRWNCKYHIVFAPKYRRQAFYGEKRRAVGSILRKLCEWKNVRILEAECCAD:Sequence : ccEcccccEEccEEEEEEccGGGcccccHHHHHHHHHHHHHHHHHTTcEEEEEEEccc:Sec Str : ========================================================:RP:SCP|5->129|2a6mA1|9e-33|35.0|123/130|d.58.57.1 :============================================================:BL:SWS|1->152|T200_SALTY|3e-91|100.0|152/152 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->126|PF01797|8e-23|49.5|111/119|Transposase_17 61: . . . * . .: 120 :HIHMLLEIPPKMSVSSFMGYLKGKSSLMLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTA:Sequence :cEEEEEEccTTTcHHHHHHHHHHHHHHHHHHHcTHHHHHHccccccccccEEEEEccccH:Sec Str :============================================================:RP:SCP|5->129|2a6mA1|9e-33|35.0|123/130|d.58.57.1 :============================================================:BL:SWS|1->152|T200_SALTY|3e-91|100.0|152/152 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->126|PF01797|8e-23|49.5|111/119|Transposase_17 121: . . + . . .: 180 :KIQDYIKHQLEEDKMGEQLSIPYPGSPFTGRK :Sequence :HHHHHHHTccccccHHHHHHHHHHHHTcccc :Sec Str :========= :RP:SCP|5->129|2a6mA1|9e-33|35.0|123/130|d.58.57.1 :================================ :BL:SWS|1->152|T200_SALTY|3e-91|100.0|152/152 :$$$$$$ :RP:PFM|16->126|PF01797|8e-23|49.5|111/119|Transposase_17