[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF70056.1"

            "putative homeobox protein"
YBGS_SALTY  "RecName: Full=Uncharacterized protein ybgS;Flags: Precursor;"

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-1111111111-1111111111111111111111-----1111111111111111-1111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKMTKLTTLLLTATLGLASGAALAAESNAQSSNGQANSAANAGQVAPDARQNVAPNDVNN:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|6->44|lttllltatlglasgaalaaesnaqssngqansaanagq : XXXXXXXXX:SEG|52->70|nvapndvnnndintngntn : ================:BL:SWS|45->128|YBGS_SALTY|7e-34|98.8|84/128 61: . . . * . .: 120 :NDINTNGNTNSTMQHPDGSTMNHDGMTKDEEHKNTMCKDGRCPDINKKVETSNGVNNDVN:Sequence :XXXXXXXXXX :SEG|52->70|nvapndvnnndintngntn :============================================================:BL:SWS|45->128|YBGS_SALTY|7e-34|98.8|84/128 121: . . + . . .: 180 :TKTDGTTQ :Sequence :======== :BL:SWS|45->128|YBGS_SALTY|7e-34|98.8|84/128