[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF70056.1 sent8 ACF70056.1 "putative homeobox protein"
MKMTKLTTLLLTATLGLASGAALAAESNAQSSNGQANSAANAGQVAPDARQNVAPNDVNN
NDINTNGNTNSTMQHPDGSTMNHDGMTKDEEHKNTMCKDGRCPDINKKVETSNGVNNDVN
TKTDGTTQ
//