[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF70211.1"

            "type I secretion membrane fusion protein, HlyD family"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------1------1-----------------1-1221122-2----------433-221--221--121-1--5662-2--1--2-------------1------------------------------------------------------------------------------------------------------------------------1-----------------1-1------------------------------------------4111----11-574421-1133----------2-33633333341-344336244435212-12-32122532111111111-31141111111111111111111111111111111--1111-221-3111231----1111111-1-111323-----241-1-1-3232114-22332--111111-1311----2131134111--2---11-1--------11111---------------2--11112112-12-1-11211121111112224111--111---------1-211--222-12----2---------2-1-----21--4424222222122222222221--1------211123313222--2-111--1111--112111------------11111211-1113333443225334-133---------131122222232344--1-------11111-4---------------1---------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------3---------1--------------------1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKINQHDAAMDDPDIQRERAFSGAGRIVLICSLLFLILGIWAWFGRLDEVSTGNGKVIPS:Sequence : EEEEEcTTcEEEEEETTEEEE:Sec Str : ================:RP:SCP|45->95|1bdoA|9e-06|13.7|51/80|b.84.1.1 : =====================:BL:SWS|40->396|CYAD_BORPE|5e-28|29.2|343/440 61: . . . * . .: 120 :SREQVLQSLDGGILAQLTVREGDRVQANQIVARLDPTRLASNVGESAAKYRASLASSARL:Sequence :EEcHHHHHHHccEEEEEcccTTcEEcTTcEEEEEEEcccEEEEHH :Sec Str : XXXXXXXXXXXXXXX:SEG|106->122|saakyraslassarlta :=================================== :RP:SCP|45->95|1bdoA|9e-06|13.7|51/80|b.84.1.1 :============================================================:BL:SWS|40->396|CYAD_BORPE|5e-28|29.2|343/440 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|72->309|PF00529|2e-07|26.7|210/259|HlyD 121: . . + . . .: 180 :TAEVNDLPLAFPAELNGWPDLIAAETRLYKSRRAQLADTEAELRDALASVNKELAITQRL:Sequence : HHHHHHHHHHHHHHHHHHHHH HHH:Sec Str :XX :SEG|106->122|saakyraslassarlta : =======================================:RP:SCP|142->223|1wp1A|2e-04|14.8|81/456|f.5.1.1 :============================================================:BL:SWS|40->396|CYAD_BORPE|5e-28|29.2|343/440 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|72->309|PF00529|2e-07|26.7|210/259|HlyD 181: . * . . . .: 240 :EKSGAASHVEVLRLQRQKSDLGLKITDLRSQYYVQAREALSKANAEVDMLSAILKGREDS:Sequence :HHccccTTHH HHHHHTHHHHH HHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :=========================================== :RP:SCP|142->223|1wp1A|2e-04|14.8|81/456|f.5.1.1 :============================================================:BL:SWS|40->396|CYAD_BORPE|5e-28|29.2|343/440 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|72->309|PF00529|2e-07|26.7|210/259|HlyD 241: + . . . . *: 300 :VTRLTVRSPVRGIVKNIQVTTIGGVIPPNGEMMEIVPVDDRLLIETRLSPRDIAFIHPGQ:Sequence :HHcccccccccEEEEEEccccTTEEEccccEEEEEEcEcccEEEEEccccEEEEEEcccT:Sec Str : =========================================================:RP:SCP|244->393|1x8mA|3e-21|17.8|146/259|b.82.1.13 :============================================================:BL:SWS|40->396|CYAD_BORPE|5e-28|29.2|343/440 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|72->309|PF00529|2e-07|26.7|210/259|HlyD 301: . . . . + .: 360 :RALVKITAYDYAIYGGLDGVVETISPDTIQDKVKPEIFYYRVFIRTHQDYLQNKSGRRFS:Sequence :TEEEcTTccccccE EEccccccc ccEEccccEEEEEcc :Sec Str :============================================================:RP:SCP|244->393|1x8mA|3e-21|17.8|146/259|b.82.1.13 :============================================================:BL:SWS|40->396|CYAD_BORPE|5e-28|29.2|343/440 :$$$$$$$$$ :RP:PFM|72->309|PF00529|2e-07|26.7|210/259|HlyD 361: . . . * . .: 420 :IVPGMIATVDIKTGEKTIVDYLIKPFNRAKEALRER :Sequence : :Sec Str :####################### :PROS|361->383|PS00543|HLYD_FAMILY|PDOC00469| :================================= :RP:SCP|244->393|1x8mA|3e-21|17.8|146/259|b.82.1.13 :==================================== :BL:SWS|40->396|CYAD_BORPE|5e-28|29.2|343/440