[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF70211.1 sent8 ACF70211.1 "type I secretion membrane fusion protein, HlyD family"
MKINQHDAAMDDPDIQRERAFSGAGRIVLICSLLFLILGIWAWFGRLDEVSTGNGKVIPS
SREQVLQSLDGGILAQLTVREGDRVQANQIVARLDPTRLASNVGESAAKYRASLASSARL
TAEVNDLPLAFPAELNGWPDLIAAETRLYKSRRAQLADTEAELRDALASVNKELAITQRL
EKSGAASHVEVLRLQRQKSDLGLKITDLRSQYYVQAREALSKANAEVDMLSAILKGREDS
VTRLTVRSPVRGIVKNIQVTTIGGVIPPNGEMMEIVPVDDRLLIETRLSPRDIAFIHPGQ
RALVKITAYDYAIYGGLDGVVETISPDTIQDKVKPEIFYYRVFIRTHQDYLQNKSGRRFS
IVPGMIATVDIKTGEKTIVDYLIKPFNRAKEALRER
//