[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF70265.1"

            "ABC-type dipeptide/oligopeptide/nickel transporter, permease component"
            ""

OrgPattern 33211-1233333331141332112115332212---1-----113-52-A95-544321322-3-11 -1129242333-3-12222-2311292222223222-557-6165982233269511111331262656831222311323-411111--------2--------11--1111111111111111111111111214657522169331122322-----1--32114222----111-1-1173333881323666664564546445A76663655314B52-222222E6144434434544445222212221321-12111--22-111122343332333-11122111111121111111111111311--111111C26244434541422211111133143A-111A853--181-346216431-----1111121FBI--4743B19A9999979AH-22A21A2DNL1-hPPQHHCVRJKKI3-114A9B6BB5CD1111111123311118-------------------------------11--9EABB45555433333337844441444B5396--2231142243B49O13--12121----------21-345131242232231111111211----12111111------111111111112-121165311111113-1111--2---1--1-12---111--------66FD3866666666666-6666666666666665666BBB982255555555555555555965555563-566666656666---1-----------64833312322212412211--1-1-12211111143614222-9991----1---146664444456488-----------------2----11111-11--6-1-1-------2---111----1----33843ADA77212 -----------------------------------------------------------------------------------------------------------------1--------------------------------------------1----2---------1-----------1------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKLFFSHFLRLIILLVLVAVGTFILLSFSPVDPIRAYIGNDLLHVPPEQYARIAARWGLD:Sequence : XXXXXXXXXX :SEG|9->18|lrliillvlv : ==========================================:BL:SWS|19->306|Y209_BRUME|3e-35|32.4|278/315 61: . . . * . .: 120 :QPLWERFGHWFWRLLQGDMGYSMLFNMPVASVIRERFATSFALLAGAWLLSGVLGVTLGF:Sequence : ==============================:RP:SCP|91->253|3dhwA1|2e-06|13.6|147/203|f.58.1.1 :============================================================:BL:SWS|19->306|Y209_BRUME|3e-35|32.4|278/315 121: . . + . . .: 180 :LAGRFLHRWPDKMICRISYLLSSLPTFWIAMLLLALFAVRWPVLPVCCAWDPGNNAGTAL:Sequence :============================================================:RP:SCP|91->253|3dhwA1|2e-06|13.6|147/203|f.58.1.1 :============================================================:BL:SWS|19->306|Y209_BRUME|3e-35|32.4|278/315 181: . * . . . .: 240 :LSERLRHLVLPVCALSLLGMGQIALHTREKIASVMKSEFIRFARAQGDKGWSLLCHQVLR:Sequence :============================================================:RP:SCP|91->253|3dhwA1|2e-06|13.6|147/203|f.58.1.1 :============================================================:BL:SWS|19->306|Y209_BRUME|3e-35|32.4|278/315 241: + . . . . *: 300 :HAITPALCLQFASLGELMGGALLAEKVFAYPGLGQATIDAGLRGDVPLLMGIVLFCTLLV:Sequence : XXXXXXXXXXXX :SEG|254->265|lgelmggallae :============= :RP:SCP|91->253|3dhwA1|2e-06|13.6|147/203|f.58.1.1 :============================================================:BL:SWS|19->306|Y209_BRUME|3e-35|32.4|278/315 301: . . . . + .: 360 :FAGNTISAWLVVVLNRSLERPDAL :Sequence :====== :BL:SWS|19->306|Y209_BRUME|3e-35|32.4|278/315