[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:aroG"

aroG        "3-deoxy-7-phosphoheptulonate synthase, Phe-sensitive"
AROG_ECOLI  "RecName: Full=Phospho-2-dehydro-3-deoxyheptonate aldolase, Phe-sensitive;         EC=2.5.1.54;AltName: Full=Phospho-2-keto-3-deoxyheptonate aldolase;AltName: Full=3-deoxy-D-arabino-heptulosonate 7-phosphate synthase;AltName: Full=DAHP synthetase;"

OrgPattern -------------------------------------------------------------------- 11--1--1111-1--1-----1---1------11111111-----11-1---111-----11--111---12222222----1-----------------------------------------11111111111111111-----1-11---1111111111--11111-111111111111111------------------------------------------------------------------------------------------212111----12222222222222-------------222122222-----2------------11----1-----11--11---------------1-1111--------111---1-1-----------------------1--1---11-111---------1-----1----------------------------------------------------2221222222222222222222221222212221122221222232221112111121111111111-222--1------------1111111122222-11----------------------------4421213-1-23333333333333333333111111111111133333333334334433-333333333334333333333333333333333333323333333333333313233333333331111111111111122212222-2211112112222222211121222222222222222221111111111333423333333441111111111111111--11------------1-------------------------------------131 ------------1122222233422232222222223222322222222222221222222222322222223332223221222222-23222222222262436-21-------------------------------------------------------------2------------------3----4233- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNYQNDDLRIKEINELLPPVALLEKFPATENAANTVAHARKAIHKILKGNDDRLLVVIGP:Sequence : ccTTcccccccccccccHHHHHHHccccHHHccccccccEEETTEEEcTTcccEEEEEE:Sec Str : ======================================================:RP:SCP|7->349|1gg1A|e-162|91.7|339/339|c.1.10.4 :============================================================:BL:SWS|1->350|AROG_ECOLI|0.0|91.7|350/350 : $$$$$$$$$$$$$$$$$$:RP:PFM|43->338|PF00793|2e-62|56.3|263/278|DAHP_synth_1 61: . . . * . .: 120 :CSIHDPAAAKEYAARLLALRDELQGELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQIN:Sequence :EEcccHHHHHHHHHHHHHHHHHHTccccEEEEEEcccTTcccccccccHHHHHHHHHcHH:Sec Str : XXXXXXXXXXXXX :SEG|67->79|aaakeyaarllal :============================================================:RP:SCP|7->349|1gg1A|e-162|91.7|339/339|c.1.10.4 :============================================================:BL:SWS|1->350|AROG_ECOLI|0.0|91.7|350/350 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|43->338|PF00793|2e-62|56.3|263/278|DAHP_synth_1 121: . . + . . .: 180 :DGLRIARKLLLDINDSGLPAAGEFLDMITPQYLADLMSWGAIGARTTESQVHRELASGLS:Sequence :HHHHHHHHHHHHTHHHccEEEEEcccGGGHHHHHTTccEEEEcGGGTTcHHHHHHHHHTT:Sec Str :============================================================:RP:SCP|7->349|1gg1A|e-162|91.7|339/339|c.1.10.4 :============================================================:BL:SWS|1->350|AROG_ECOLI|0.0|91.7|350/350 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|43->338|PF00793|2e-62|56.3|263/278|DAHP_synth_1 181: . * . . . .: 240 :CPVGFKNGTDGTIKVAIDAINAAGAPHCFLSVTKWGHSAIVNTSGNGDCHIILRGGKAPN:Sequence :cEEEEEccTTccGGGHHHHHcTTccTTEEEEEcGHHHHHHHHHTTcccEEEEEccEEccc:Sec Str :============================================================:RP:SCP|7->349|1gg1A|e-162|91.7|339/339|c.1.10.4 :============================================================:BL:SWS|1->350|AROG_ECOLI|0.0|91.7|350/350 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|43->338|PF00793|2e-62|56.3|263/278|DAHP_synth_1 241: + . . . . *: 300 :YSAQHVAEVKEGLIKAGLTPQVMIDFSHANSCKQFQKQMEVCADVCQQIAGGEKAIIGVM:Sequence :ccEEccTHHHHHHHHHTTcccEEEEHHHHTccGGGHHHHHHHHHHHHHHHHcHTcccEEE:Sec Str :============================================================:RP:SCP|7->349|1gg1A|e-162|91.7|339/339|c.1.10.4 :============================================================:BL:SWS|1->350|AROG_ECOLI|0.0|91.7|350/350 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|43->338|PF00793|2e-62|56.3|263/278|DAHP_synth_1 301: . . . . + .: 360 :VESHLVEGNQSLESGQPLTYGKSITDACIGWEDTDALLRQLSAAVKARRG :Sequence :EEEEccGGGccEGGHccccGGGcEEGGGHHHHHHHHHHHHHHHHHHHccc :Sec Str :================================================= :RP:SCP|7->349|1gg1A|e-162|91.7|339/339|c.1.10.4 :================================================== :BL:SWS|1->350|AROG_ECOLI|0.0|91.7|350/350 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|43->338|PF00793|2e-62|56.3|263/278|DAHP_synth_1