[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:artP"

artP        "arginine ABC transporter, ATP-binding protein"
ARTP_SHIFL  "RecName: Full=Arginine transport ATP-binding protein artP;         EC=3.6.3.-;"

OrgPattern SSI7LHGGSSTQSNUHgGPNKPOVuKOikVgRHADDCBGFHFCQXRTiKO**f9PWNQPIMGHAU169 SbfI*bWZllpPaNUOSML-LfAAW*MMMMMMpjhkk***PxW*n*rekkdNwurMOXAAppqf*m****WWYYYwbZVNrciAAB9ALLMG4HBDH--DFOIHHWFUOK7898998CBCBBBBGSMKPUKMTQWPfghy*DDEsVmhcmhgcXeQRLGLGMHWaWb**yUELDJCCEKCHECZVZNNqg8OYp********z********ttyt***Zlt*zbillkkll**WfghhhdceffffeeUbXYYtZXXurWLVUWnmKLurWRMUceYaYkhmnmhqjmlfkfiecflfifZZZYYaacbbaYZtheZYZgghcf*p*********b*ah***QZZY*khli*WeQK**miWWejQVfWdcKXUUJYVSSMIKIGIYU***TOn****u***********-mm*hd*l***Q9**************IJL**********MLMMMMMMtWbIMfW*44554444552254894576565568595IDHHFB***********x*y*v********f********9Mvtovmohl*y****ZnhPRIQjUFGFFEFFROMakcXv*QbVplSfpaYlIYXURRXhVVYWSYouWyKIIMFKKKLIF9BBCCBCBBHOIEIJImjpMpPbGRKtNTSTSLUYRRQROSWTTWW5-9JUQK1--111*w**V*mtwwvuxwyrr-vsrttqvutwwxtoosonm*****dbZjjfhiijhjiggjghh*nifppmrM3************33FGAC9ABKKLKRG*m*WWVXTTGLMJJRLQYNOPNOEPEMTmWqnppu***p**xyg***CEDBCDDCEHdkj*lnmmnz*vywRRPLLLLLMLDBCB44JTOOJKLK99789889*BQBAA9B-E8EBFEBHHH9GDAEA889PdkSRl*kliDaN -2--RK8-ND39FMED5997CEAG9F9AA8999HDG8BAAABA778BCDFDFKGDCGA798843434421331563212242223424-4C757526656427BA6-AQHXKQNVORH9C8EMIgf7b8**e3ZIaHEF8VCCVMBIB8BQAA*DRIHjCS*9bGXAUOP*GVOGB7A9*AAB9AWNT*8ZW8AkSWVD -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSIQLNGINCFYGAHQALFDITLDCPEGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLT:Sequence : ==========================================================:RP:SCP|3->241|1b0uA|2e-45|40.2|239/258|c.37.1.12 :============================================================:BL:SWS|1->242|ARTP_SHIFL|e-122|95.0|242/242 : $$$$$$$$$$$$$$$$$$$:RP:PFM|42->170|PF00005|2e-17|43.3|120/123|ABC_tran 61: . . . * . .: 120 :IAGNHFDFTKTPSDKAIRELRQNVGMVFQQYNLWPHLTVVQNLIEAPCRVLGLTKDQALA:Sequence : XXX:SEG|118->132|alaraekllerlrlk :============================================================:RP:SCP|3->241|1b0uA|2e-45|40.2|239/258|c.37.1.12 :============================================================:BL:SWS|1->242|ARTP_SHIFL|e-122|95.0|242/242 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|42->170|PF00005|2e-17|43.3|120/123|ABC_tran 121: . . + . . .: 180 :RAEKLLERLRLKPYSDRYPLHLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQI:Sequence :XXXXXXXXXXXX :SEG|118->132|alaraekllerlrlk : ############### :PROS|142->156|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|3->241|1b0uA|2e-45|40.2|239/258|c.37.1.12 :============================================================:BL:SWS|1->242|ARTP_SHIFL|e-122|95.0|242/242 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|42->170|PF00005|2e-17|43.3|120/123|ABC_tran 181: . * . . . .: 240 :VSIIHELAETNITQVIVTHEVEVARKTASRVIYMENGHIVEHGDAGCFAHPQTEAFKNYL:Sequence :============================================================:RP:SCP|3->241|1b0uA|2e-45|40.2|239/258|c.37.1.12 :============================================================:BL:SWS|1->242|ARTP_SHIFL|e-122|95.0|242/242 241: + . . . . *: 300 :SH :Sequence := :RP:SCP|3->241|1b0uA|2e-45|40.2|239/258|c.37.1.12 :== :BL:SWS|1->242|ARTP_SHIFL|e-122|95.0|242/242