[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF67784.1 sent8 artP "arginine ABC transporter, ATP-binding protein"
MSIQLNGINCFYGAHQALFDITLDCPEGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLT
IAGNHFDFTKTPSDKAIRELRQNVGMVFQQYNLWPHLTVVQNLIEAPCRVLGLTKDQALA
RAEKLLERLRLKPYSDRYPLHLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQI
VSIIHELAETNITQVIVTHEVEVARKTASRVIYMENGHIVEHGDAGCFAHPQTEAFKNYL
SH
//