[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:bioF"

bioF        "8-amino-7-oxononanoate synthase"
BIOF_SALHS  "RecName: Full=8-amino-7-oxononanoate synthase;         Short=AONS;         EC=2.3.1.47;AltName: Full=8-amino-7-ketopelargonate synthase;AltName: Full=7-keto-8-amino-pelargonic acid synthetase;         Short=7-KAP synthetase;AltName: Full=L-alanine--pimeloyl-CoA ligase;"

OrgPattern --1---------------------1--1---1----1111111-----------1111111-111-11 112-1-1-----1-11122-211171222225111121131231-111----2111-2--3222315333-------------111114434-433---22434342326111111121222221222334223131-------1-2121112--111111112111111211111111111111111112112222222222222222-1221222211-1111------2112222223222222211111-----------------1----------------------------------------------------111----------------------1--1---1-------1--111111-2225334-----452452223343322222222222-565564542822233232532234232333223233523333333332443323222322222221111111111111111111-23333121132333324333333223333234233232112321111-124-1-1112111311111111322111--1111212221111212211112222243221--1-11111111111111111111222212112222222222222222222222221--1111-1----22222222223233333-23233333332333223322222222222222222222222224222332211222222222222--1222222333311412111-1-111111--1-111111111211111111111121111133222332312223333333332222222222221111111-111111--------1------------------1--------11111-1---132 22--334-52314445653466668674444547443444444444544545554543433343333323323332323333333344-4A5645464444447641534B9B86885235553946B2GZA178955249566856544634D366668AB57664644H56654132L3233548C56533497763 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--

Master   AminoSeq   


1: . . . . + .: 60 :MSWQQRVDDALTARRVTDTLRRRYVVSQGAGRWLVANGRQYLNFSSNDYLGLSQHPQIIR:Sequence :ccHTccHHHHHHHTTGGGccccccccccccccEEEETTEEEEEcccccTTcGGGcHHHHH:Sec Str : ===========================================================:RP:SCP|2->384|1bs0A|e-142|73.6|383/383|c.67.1.4 :============================================================:BL:SWS|1->385|BIOF_SALHS|0.0|100.0|385/385 61: . . . * . .: 120 :AWQQAATRFGVGSGGSGHISGYSVAHQALEEELAQWLGYPRALLFISGFAANQAVITALM:Sequence :HHHHHHHHHcccccccTTTTcccHHHHHHHHHHHHHHTccEEEEEccHHHHHHHHHHHcc:Sec Str : XXXXXXXXXXXXXX :SEG|70->83|gvgsggsghisgys :============================================================:RP:SCP|2->384|1bs0A|e-142|73.6|383/383|c.67.1.4 :============================================================:BL:SWS|1->385|BIOF_SALHS|0.0|100.0|385/385 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|88->128|PF01053|8e-05|53.7|41/384|Cys_Met_Meta_PP 121: . . + . . .: 180 :KKNDRIVADRLSHASLLEAANLSPAQLRRFIHNDTQHLSRLLQSPCVGQQLVVTEGVYSM:Sequence :cTTcEEEEETTccHHHHHHHHHcccEEEEEcTTcHHHHHHHHHTcccccEEEEEEcccTT:Sec Str :============================================================:RP:SCP|2->384|1bs0A|e-142|73.6|383/383|c.67.1.4 :============================================================:BL:SWS|1->385|BIOF_SALHS|0.0|100.0|385/385 :$$$$$$$$ :RP:PFM|88->128|PF01053|8e-05|53.7|41/384|Cys_Met_Meta_PP 181: . * . . . .: 240 :DGDSAPLAEIQHIARRHHAWLLVDDAHGIGVTGDEGRGTCWQRGVKPELLVVTFGKGFGV:Sequence :TcccccHHHHHHHHHHHTcEEEEEcTTTTTTccGGGccHHHHHTcGGGEEEEEcccTTcc:Sec Str : ########:PROS|233->242|PS00599|AA_TRANSFER_CLASS_2|PDOC00518| :============================================================:RP:SCP|2->384|1bs0A|e-142|73.6|383/383|c.67.1.4 :============================================================:BL:SWS|1->385|BIOF_SALHS|0.0|100.0|385/385 241: + . . . . *: 300 :SGAAVLCSESVADYLLQFARHLVYSTSMPPAQAQALSASLAVIRSDEGGERREKLAALVQ:Sequence :ccEEEEEcHHHHHHHHHHcHHHHccccccHHHHHHHHHHHHHHHHcTHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXX :SEG|269->281|ppaqaqalsasla :## :PROS|233->242|PS00599|AA_TRANSFER_CLASS_2|PDOC00518| :============================================================:RP:SCP|2->384|1bs0A|e-142|73.6|383/383|c.67.1.4 :============================================================:BL:SWS|1->385|BIOF_SALHS|0.0|100.0|385/385 301: . . . . + .: 360 :RFRAGVNASRFTLLNAHSAIQPLIVGDNSRALRLAEALRQQGCWATAIRPPTVPVGTARL:Sequence :HHHHHHHHTTcccccccccEEEEEcccHHHHHHHHHHHHHTTEEcEEEcTTTccGGGcEE:Sec Str :============================================================:RP:SCP|2->384|1bs0A|e-142|73.6|383/383|c.67.1.4 :============================================================:BL:SWS|1->385|BIOF_SALHS|0.0|100.0|385/385 361: . . . * . .: 420 :RLTLTQAHEACDIDRLLEVLHGAGE :Sequence :EEEccTTccHHHHHHHHHHHHHHHH :Sec Str :======================== :RP:SCP|2->384|1bs0A|e-142|73.6|383/383|c.67.1.4 :========================= :BL:SWS|1->385|BIOF_SALHS|0.0|100.0|385/385