[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ccmF.1"

ccmF        "cytochrome c-type biogenesis protein CcmF"
            ""

OrgPattern 11-2-1------------1----11------1-----------------11-1--------------- 1111--------11--------------------1-1111----------------------1-1--------------111-----------------------11111-----------------------11-11111---11----------------1--------------------11111----------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1-11---11111-------1--111111111111111111111111111111111-11111111111-111121111111111113111111112111111111111111111111111111111-11111111111111111111-11-2----------------------4111221111-11----1-1---21-1-1121111111121111--1--2111111121111221211----1111---------------------------22-121111111122111222222222222---1111------21--2-12222222222-222222222222222222111122---323333333333333312212222--111111111111---1-----1111111-1222222222212112-------1211111111111111111111----------2222111112222211222222231111111-111111------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1-11---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MMPEYGHALLCLALGVALLLSVYPLWGVARGDARMMASAGVFAWLLFICVAGAFFVLVHA:Sequence : XXXXXXXXXXXXX :SEG|8->20|allclalgvalll :============================================================:BL:SWS|1->642|CCMF_ECOLI|0.0|84.6|642/647 61: . . . * . .: 120 :FVVNDFTVAYVAGNSNTQLPVWYRVAATWGAHEGSLLLWVLLMSGWTLAVAVFSRQVPAD:Sequence :============================================================:BL:SWS|1->642|CCMF_ECOLI|0.0|84.6|642/647 121: . . + . . .: 180 :IVARVLAVMGMVCAGFLAFILFTSGPFARTLPAFPVEGRDLNPLLQDPGLIFHPPLLYMG:Sequence :============================================================:BL:SWS|1->642|CCMF_ECOLI|0.0|84.6|642/647 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|151->292|PF01578|2e-21|48.2|137/212|Cytochrom_C_asm 181: . * . . . .: 240 :YVGFSVAFAFAIAALLSGRLDSAFTRFARPWTLAAWVFLTLGIVLGSAWAYYELGWGGWW:Sequence :============================================================:BL:SWS|1->642|CCMF_ECOLI|0.0|84.6|642/647 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|151->292|PF01578|2e-21|48.2|137/212|Cytochrom_C_asm 241: + . . . . *: 300 :FWDPVENASFMPWLAGTALLHSLAVTEQRAGFKAWTLLLSICAFSLCLLGTFLVRSGVLV:Sequence :============================================================:BL:SWS|1->642|CCMF_ECOLI|0.0|84.6|642/647 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|151->292|PF01578|2e-21|48.2|137/212|Cytochrom_C_asm 301: . . . . + .: 360 :SVHAFASDPARGMFILAFMVLVTGGSLLLFAVRGHRVRSRVNNALWSRESLLLGNNVLLM:Sequence : XXXX:SEG|357->375|vllmaamlvvllgtllplv :============================================================:BL:SWS|1->642|CCMF_ECOLI|0.0|84.6|642/647 361: . . . * . .: 420 :AAMLVVLLGTLLPLVHKQLGLGSISVGEPFFNTMFTWLMVPFALLLGVGPLVRWGRDRPR:Sequence :XXXXXXXXXXXXXXX :SEG|357->375|vllmaamlvvllgtllplv :============================================================:BL:SWS|1->642|CCMF_ECOLI|0.0|84.6|642/647 421: . . + . . .: 480 :NIRTLLLTALVSTLVLSVLLPWLLEDKIIAMTAVGMAMACWIAVLAVAEAVQRVSRGTKT:Sequence : XXXXXXXXXXXXXXXXXXXXX :SEG|424->444|tllltalvstlvlsvllpwll :============================================================:BL:SWS|1->642|CCMF_ECOLI|0.0|84.6|642/647 481: . * . . . .: 540 :SLSYWGMVAAHLGLAVTITGIAFSQNYSVERDVRMRAGDSVTIHDYRFTFPEVRDITGPN:Sequence :============================================================:BL:SWS|1->642|CCMF_ECOLI|0.0|84.6|642/647 541: + . . . . *: 600 :YRGGVALIGVTRHGEPEAVLHAEKRLYNTSRMVMTEAAIDGGLTRDLYAALGEELDNGAW:Sequence :============================================================:BL:SWS|1->642|CCMF_ECOLI|0.0|84.6|642/647 601: . . . . + .: 660 :AVRLYYKPFVRWIWAGGLLMALGGLLCLADPRYRRRKPLPEAG :Sequence : XXXXXXXXXXXXXXX :SEG|615->629|aggllmalggllcla :========================================== :BL:SWS|1->642|CCMF_ECOLI|0.0|84.6|642/647