[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF67742.1 sent8 ccmF.1 "cytochrome c-type biogenesis protein CcmF"
MMPEYGHALLCLALGVALLLSVYPLWGVARGDARMMASAGVFAWLLFICVAGAFFVLVHA
FVVNDFTVAYVAGNSNTQLPVWYRVAATWGAHEGSLLLWVLLMSGWTLAVAVFSRQVPAD
IVARVLAVMGMVCAGFLAFILFTSGPFARTLPAFPVEGRDLNPLLQDPGLIFHPPLLYMG
YVGFSVAFAFAIAALLSGRLDSAFTRFARPWTLAAWVFLTLGIVLGSAWAYYELGWGGWW
FWDPVENASFMPWLAGTALLHSLAVTEQRAGFKAWTLLLSICAFSLCLLGTFLVRSGVLV
SVHAFASDPARGMFILAFMVLVTGGSLLLFAVRGHRVRSRVNNALWSRESLLLGNNVLLM
AAMLVVLLGTLLPLVHKQLGLGSISVGEPFFNTMFTWLMVPFALLLGVGPLVRWGRDRPR
NIRTLLLTALVSTLVLSVLLPWLLEDKIIAMTAVGMAMACWIAVLAVAEAVQRVSRGTKT
SLSYWGMVAAHLGLAVTITGIAFSQNYSVERDVRMRAGDSVTIHDYRFTFPEVRDITGPN
YRGGVALIGVTRHGEPEAVLHAEKRLYNTSRMVMTEAAIDGGLTRDLYAALGEELDNGAW
AVRLYYKPFVRWIWAGGLLMALGGLLCLADPRYRRRKPLPEAG
//