[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:cpsB"

cpsB        "mannose-1-phosphate guanylyltransferase"
MANC_SALTY  "RecName: Full=Mannose-1-phosphate guanylyltransferase manC;         EC=2.7.7.13;AltName: Full=GDP-mannose pyrophosphorylase;         Short=GMPP;         Short=GMP;"

OrgPattern -----------------------111111--------1-111-11-11-1222-1111111---1--- 111-1---------------------------------------11121111111111111131--------111-------11111-222313111--21111121121---------------22222222212--------112332333222222222233113333121121121111-111111-1-----------1----1-------1-11----1------13------------------------------------------------------------------------------------------2--31111111111211111211-1----2-11--12-21---11-2--12111111-----211112121111222222222221-22122431121-11111121111111111211211112-1111111111111111--------------11-21---11-2-111111111----4433442244422463333234552-2111-1-221-1-1222-111122111-------11121111111221111111122322222211111132--11-------1111111111-121321-22111-111--1------1------------1111------1111-2-1222112111-2112121221212221222-2111---2122222222222222111-11111-111-111111-1----11111111111121---------------------1---11323323233211212332121222211----111111-1-1111111111111111-11111111------------------------------------111111-111121 ------------------------------------------------11---------------------------------------121-111------1------------------------------------------------------------1---------1--------------------1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRQTKLYPVVMAGGSGSRLWPLSRVLYPKQFLCLKGDLTMLQTTICRLNGVECESPVVIC:Sequence :TccccEEEEEEcccccGGGTTTccTTccGGGcccGGGccHHHHHHHHHTTTccGGGEEEE:Sec Str : ========================================================:RP:SCP|5->292|2cu2A2|1e-51|34.5|267/268|c.68.1.20 :============================================================:BL:SWS|1->478|MANC_SALTY|0.0|99.6|478/480 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->287|PF00483|6e-16|37.3|228/238|NTP_transferase 61: . . . * . .: 120 :NEQHRFIVAEQLRQLNKLTENIILEPAGRNTAPAIALAALAATRQHTDCDPLMLVLAADH:Sequence :EEGGGHHHHGGGccccccGGEEEEEccccHHHHHHHHHHHHHHHHHHHHHGGGGcccTTT:Sec Str : XXXXXXXXXXX :SEG|92->102|apaialaalaa :============================================================:RP:SCP|5->292|2cu2A2|1e-51|34.5|267/268|c.68.1.20 :============================================================:BL:SWS|1->478|MANC_SALTY|0.0|99.6|478/480 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->287|PF00483|6e-16|37.3|228/238|NTP_transferase 121: . . + . . .: 180 :AIANEEAFRDAVRGAMPYADAGKLVTFGIVPDLPETGYGYIRRGDVVPGATDAVAFEVAQ:Sequence :cccTHHHHHHHHHHHHHHTTTTTccccccHHHHHHHHHHTTcccHHHHTTccHHHHTTcc:Sec Str :============================================================:RP:SCP|5->292|2cu2A2|1e-51|34.5|267/268|c.68.1.20 :============================================================:BL:SWS|1->478|MANC_SALTY|0.0|99.6|478/480 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->287|PF00483|6e-16|37.3|228/238|NTP_transferase 181: . * . . . .: 240 :FVEKPGLETAQAYVASGDYYWNSGMFLFRAGRYLEELKKFRPDILAACEQAMRGVDPDLD:Sequence :cccccHHHHHHHHccccccccccHHHHHHHHHHTTTcHHHHHHHHHHHTTcEEEcHHHHH:Sec Str :============================================================:RP:SCP|5->292|2cu2A2|1e-51|34.5|267/268|c.68.1.20 :============================================================:BL:SWS|1->478|MANC_SALTY|0.0|99.6|478/480 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->287|PF00483|6e-16|37.3|228/238|NTP_transferase 241: + . . . . *: 300 :FIRVDEEAFLACPEESIDYAVMERTADAVVMPMDAGWSDVGSWSSLWEISAHTPEGNVHH:Sequence :HTTcccccEEEEccccHHEHHHHHHHHHHHHHHTTcEEEEEcGGGcccTTcccTTccccc:Sec Str :==================================================== :RP:SCP|5->292|2cu2A2|1e-51|34.5|267/268|c.68.1.20 : ======:RP:SCP|295->357|2cu2A1|2e-11|19.0|63/67|b.81.4.1 :============================================================:BL:SWS|1->478|MANC_SALTY|0.0|99.6|478/480 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|9->287|PF00483|6e-16|37.3|228/238|NTP_transferase 301: . . . . + .: 360 :GDVISHKTENSYVYAESGLVTTVGVKDLVVVQTKDAVLIADRHAVQDVKKVVEKIKADGR:Sequence :ccHHHHHHHHHHHHHcTccEEEEEEETTcTTHHHGGGccccEEEEEEccHHHHHcHHHHH:Sec Str : XXXXXXXXXXXXXX :SEG|318->331|glvttvgvkdlvvv :========================================================= :RP:SCP|295->357|2cu2A1|2e-11|19.0|63/67|b.81.4.1 : =============================:RP:SCP|332->477|1fi2A|7e-29|15.8|146/201|b.82.1.2 :============================================================:BL:SWS|1->478|MANC_SALTY|0.0|99.6|478/480 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|332->473|PF01050|3e-61|74.6|142/151|MannoseP_isomer 361: . . . * . .: 420 :HEHHMHREVYRPWGKYDSIDAGERYQVKRITVKPGEGLSVQMHHHRAEHWVVVAGTARVT:Sequence :HHHcccGGGccHHHHHHHHHHcccccEEEEEHHHHHHHHHHHHHHHcccEEEcHHHHHHT:Sec Str :============================================================:RP:SCP|332->477|1fi2A|7e-29|15.8|146/201|b.82.1.2 :============================================================:BL:SWS|1->478|MANC_SALTY|0.0|99.6|478/480 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|332->473|PF01050|3e-61|74.6|142/151|MannoseP_isomer 421: . . + . . .: 480 :INGEVKLLGENESIYIPLGATHCLENPGKIPLDLIEVRSGSYLEEDDVVRFEDRYGRI :Sequence :ccccccEEEEccEEEETTcccEEEccccEEcTTccEEEccccEEEEEHHHHHHccccE :Sec Str :========================================================= :RP:SCP|332->477|1fi2A|7e-29|15.8|146/201|b.82.1.2 :========================================================== :BL:SWS|1->478|MANC_SALTY|0.0|99.6|478/480 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|332->473|PF01050|3e-61|74.6|142/151|MannoseP_isomer