[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:cydD"

cydD        "ABC transporter, CydDC cysteine exporter (CydDC-E) family, permease/ATP-binding protein CydD"
            ""

OrgPattern 661211-2111-11112121-214533354432-21-1-11--41338--641223422133112--1 87E3RBGBGGI96788AAA-A722DCAA9AA87AAAJRHI4HCUDIEDG988DHK5CF44FJBCM5GPRY9CAAACDCF5YI3312128984-446A--45A755C5H7B111111111111113A96BF9ACBEB9CCFF323O6LDHNCCB7899B797B9DBCKSXVC5D87676A777577933EA3C7FHHJGJGLMBHLLJHMJJIIGKLLOAEGJIIELMMLKLOXC99999989999999B768AQFCHPQI8F8KNLABUSHB8CBIFDEGIKMLHLKKKINLJHELMIKK9A98AAABDCB98NKKIHHJJKGHCIDFJJJLNMK6MCHJNN6DDFUBDLMFLG52dbF7579416DCFG8B8B18977768759A4RNLBAD9HEICHGHIHHJHGJR-FHQFFHGJIT93VSTGUVKXYTRPJD686DCOFDFEIFBAAAAAAAAB8D7BC8K33333333344644674566554453252244833BDC9FBFFEICBCDDCAAHGGFGE9HDEKB9A523877DA996FCHCGEAFC5C4AA734446449768B9768496B6699666389987793E4555AC4D634453332332233333334625488DA79B5A596F78AA88899898BC9F9A9--87995122222IBJJ9DFDGGIDGHEDD-GDCFDBDEEGGFGCCDCCDIJMJNGIFGFCEDFEEEEFFEFEEJDBECCCC73JJLKMLIIIKLK1163354337AB955F8HBA9AB86AA88988B345544565BCDDHFDIIEHFIHCE9DGH4444454345A88JBCCBBFEFGJ88C8A98999444432A5774455--------o1F22214-42315322332263-421289E659B9A8393 1244NKG-MB64NPKGGLHIOQOWKULFFBCBCOOPEJHHGGFCCBJGMXSNcVIJOFJEDFFBA6882A95B9D8928A8888D959-NcBGLMIDBDHD7DNKE6Ela*TbSiWlHEEHHPFZbEqB**b1iOqGGHDWGKwVCIIHATC9*HSIOUGa*KeNHKpOV*oikZ6CB9*676GFcZa*HkqDImbjlM ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNKTRQKDLTRWLKQQSVISQRWLNISRLLGFMSGVLIVAQAWIMARILQHMIMENIPRE:Sequence :============================================================:BL:SWS|1->588|CYDD_ECOLI|0.0|89.6|588/588 61: . . . * . .: 120 :ALLLPFILLILVFVLRAWVVWLRERVGFHAGQHIRFEIRRQVLDRLQQAGPAWIQGKPAG:Sequence : XXXXXXXXXXXXXX :SEG|62->75|lllpfillilvfvl : ===========================================:RP:SCP|78->188|1ps9A1|2e-04|12.3|106/330|c.1.4.1 :============================================================:BL:SWS|1->588|CYDD_ECOLI|0.0|89.6|588/588 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|77->279|PF00664|6e-16|27.1|203/274|ABC_membrane 121: . . + . . .: 180 :SWATLVLEQIDDMHDYYARYLPQMALAVCVPLLIVAAIFPSNWAAALILLGTAPLIPLFM:Sequence :============================================================:RP:SCP|78->188|1ps9A1|2e-04|12.3|106/330|c.1.4.1 :============================================================:BL:SWS|1->588|CYDD_ECOLI|0.0|89.6|588/588 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|77->279|PF00664|6e-16|27.1|203/274|ABC_membrane 181: . * . . . .: 240 :AMVGMGAADANRRNFLALARLSGHFLDRLRGMETLRIFGRGEAETESIRAASQDFRQRTM:Sequence :======== :RP:SCP|78->188|1ps9A1|2e-04|12.3|106/330|c.1.4.1 : =====================================================:RP:SCP|188->427|1ai4.1|1e-33|17.5|229/763|d.153.1.2 :============================================================:BL:SWS|1->588|CYDD_ECOLI|0.0|89.6|588/588 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|77->279|PF00664|6e-16|27.1|203/274|ABC_membrane 241: + . . . . *: 300 :EVLRLAFLSSGVLEFFTSLSIALVAVYFGFSYLGELNFGHYGTGVTLAAGFLALILAPEF:Sequence :============================================================:RP:SCP|188->427|1ai4.1|1e-33|17.5|229/763|d.153.1.2 :============================================================:BL:SWS|1->588|CYDD_ECOLI|0.0|89.6|588/588 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|77->279|PF00664|6e-16|27.1|203/274|ABC_membrane 301: . . . . + .: 360 :FQPLRDLGTFYHAKAQAVGAADSLKTFLETPLAHPARGEVELAENEPVTIDAVNLIITSP:Sequence :============================================================:RP:SCP|188->427|1ai4.1|1e-33|17.5|229/763|d.153.1.2 :============================================================:BL:SWS|1->588|CYDD_ECOLI|0.0|89.6|588/588 : $$$$$$$$$$$$$$$$$$$$:RP:PFM|341->450|PF07682|6e-04|30.9|94/303|SOR 361: . . . * . .: 420 :EGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLSYQGSLRINGVELRDLSPES:Sequence :============================================================:RP:SCP|188->427|1ai4.1|1e-33|17.5|229/763|d.153.1.2 : ===============:RP:SCP|406->575|2gx8A1|6e-15|8.0|163/359|c.135.1.1 :============================================================:BL:SWS|1->588|CYDD_ECOLI|0.0|89.6|588/588 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|341->450|PF07682|6e-04|30.9|94/303|SOR 421: . . + . . .: 480 :WRQHLSWVGQNPQLPAATLRENVLLARPDASEQELYAALDAAWVSEFLPLLPQGVDTPLG:Sequence :======= :RP:SCP|188->427|1ai4.1|1e-33|17.5|229/763|d.153.1.2 :============================================================:RP:SCP|406->575|2gx8A1|6e-15|8.0|163/359|c.135.1.1 :============================================================:BL:SWS|1->588|CYDD_ECOLI|0.0|89.6|588/588 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|341->450|PF07682|6e-04|30.9|94/303|SOR 481: . * . . . .: 540 :NHASRLSVGQAQRVAVARALLNPCQLLLLDEPAASLDAHSEQRVMQALKAASKRQTTLMV:Sequence : XXXXXXXXXXXX :SEG|490->501|qaqrvavarall : ############### :PROS|486->500|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|406->575|2gx8A1|6e-15|8.0|163/359|c.135.1.1 :============================================================:BL:SWS|1->588|CYDD_ECOLI|0.0|89.6|588/588 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|503->543|PF02463|8e-04|39.0|41/536|SMC_N 541: + . . . . *: 600 :THQLEDLADWDAIWVMQDGAIVEQGSYAELSAANGAFATLLAHRQEDI :Sequence :=================================== :RP:SCP|406->575|2gx8A1|6e-15|8.0|163/359|c.135.1.1 :================================================ :BL:SWS|1->588|CYDD_ECOLI|0.0|89.6|588/588 :$$$ :RP:PFM|503->543|PF02463|8e-04|39.0|41/536|SMC_N