[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF66691.1 sent8 cydD "ABC transporter, CydDC cysteine exporter (CydDC-E) family, permease/ATP-binding protein CydD"
MNKTRQKDLTRWLKQQSVISQRWLNISRLLGFMSGVLIVAQAWIMARILQHMIMENIPRE
ALLLPFILLILVFVLRAWVVWLRERVGFHAGQHIRFEIRRQVLDRLQQAGPAWIQGKPAG
SWATLVLEQIDDMHDYYARYLPQMALAVCVPLLIVAAIFPSNWAAALILLGTAPLIPLFM
AMVGMGAADANRRNFLALARLSGHFLDRLRGMETLRIFGRGEAETESIRAASQDFRQRTM
EVLRLAFLSSGVLEFFTSLSIALVAVYFGFSYLGELNFGHYGTGVTLAAGFLALILAPEF
FQPLRDLGTFYHAKAQAVGAADSLKTFLETPLAHPARGEVELAENEPVTIDAVNLIITSP
EGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLSYQGSLRINGVELRDLSPES
WRQHLSWVGQNPQLPAATLRENVLLARPDASEQELYAALDAAWVSEFLPLLPQGVDTPLG
NHASRLSVGQAQRVAVARALLNPCQLLLLDEPAASLDAHSEQRVMQALKAASKRQTTLMV
THQLEDLADWDAIWVMQDGAIVEQGSYAELSAANGAFATLLAHRQEDI
//