[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:eprI.1"

eprI        "type III secretion apparatus needle protein"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------1-1--------------------------------1---11--------1----1----1----------------1111111111111111--------1---------------1------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDIAQLVDMLSHMAHQAGQAINDKMNGNDLLNPESMIKAQFALQQYSTFINYESSLIKMI:Sequence : cHHHHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|1->67|2g0uA1|3e-13|22.7|66/84|a.2.20.1 : ===========================================================:BL:SWS|2->70|YSCF_YEREN|9e-05|26.1|69/87 61: . . . * . .: 120 :KDMLSGIIAKI :Sequence :HHHHHHHH :Sec Str :======= :RP:SCP|1->67|2g0uA1|3e-13|22.7|66/84|a.2.20.1 :========== :BL:SWS|2->70|YSCF_YEREN|9e-05|26.1|69/87