[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF66209.1 sent8 eprI.1 "type III secretion apparatus needle protein"
MDIAQLVDMLSHMAHQAGQAINDKMNGNDLLNPESMIKAQFALQQYSTFINYESSLIKMI
KDMLSGIIAKI
//