[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:fdnH"

fdnH        "formate dehydrogenase, nitrate-inducible, iron-sulfur subunit"
FDNH_SHIFL  "RecName: Full=Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit;AltName: Full=Formate dehydrogenase-N subunit beta;         Short=FDH-N subunit beta;AltName: Full=Anaerobic formate dehydrogenase iron-sulfur subunit;"

OrgPattern 22121222344333324-5563373113-1-21-133122122-1--11-1-1121-5252---4--- -6811111111--1-2211-11--1211111-12221-111---11211-----11----2122112-31---------5bS334222-----------------1--1----------------2243333332334411333-3----------------------------------------1-1----1111111-111111111-11-1111--2---1------1-1111111111111111111--------1---11-1-------------------------------------------------------132--1111111-1-1411-111--1--9--13ni3354-49A1113----721--1------21--323-21--11111111112-1131131311----------1-1121-11212-1--312111111113----8-4-----------------------------------122-3211212233333323444413222334211232241443325213124---23----------B34-7E648CC7C999E188686683-A9A9343827322112211-2-------2A3321153-111-----46997-5H9A9787C98K8----732------A5C898-EFFEEEDDEE-EEDFEEEEDEFEECEEEE79997621AFDEEFFFFFFEDFDEE6989CBCD--455555555454---1---------1112-444434133232114-------1-12-22221-1--11114-------------2333111114422322------------123---------------------------------------------1--1-111-2- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------3-----1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSMETQDIIKRSATNAITPPPQARDYKAEVAKLIDVSSCVGCKACQVACSEWNDIRDNVG:Sequence : ccTTccEEEETTccTTccccccHHHHHHHHHEEccGGGGcccccHHcccTHHTcTTcTT:Sec Str : ===========================================================:RP:SCP|2->245|1kqfB1|2e-98|93.4|244/244|d.58.1.5 :============================================================:BL:SWS|1->283|FDNH_SHIFL|e-166|93.3|283/294 61: . . . * . .: 120 :HCVGVYDNPADLSAKSWTVMRFTETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQ:Sequence :cccTTcccccccccccccccccHHHTcccHHHHHEEcGGGTTTcccHHHHHcTTTccEEE:Sec Str :============================================================:RP:SCP|2->245|1kqfB1|2e-98|93.4|244/244|d.58.1.5 :============================================================:BL:SWS|1->283|FDNH_SHIFL|e-166|93.3|283/294 121: . . + . . .: 180 :YANGIVDFQSEHCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCP:Sequence :ccccEEEcTTTTcccccccTTTcTTccEEEGGGccGGGTHHHHHHHHHHTTccccccccc:Sec Str : ############ :PROS|133->144|PS00198|4FE4S_FER_1|PDOC00176| :============================================================:RP:SCP|2->245|1kqfB1|2e-98|93.4|244/244|d.58.1.5 :============================================================:BL:SWS|1->283|FDNH_SHIFL|e-166|93.3|283/294 181: . * . . . .: 240 :TGAIHFGTKKEMLELGEQRVEKLKARGFEHAGIYNPQGVGGTHVMYVLHHANQPELYHGL:Sequence :ccTTHHHHTTcccGGGGHHHHHccccTcTTcEEEccGGGTcccEEEEETTTTcGGGTTTc:Sec Str :============================================================:RP:SCP|2->245|1kqfB1|2e-98|93.4|244/244|d.58.1.5 :============================================================:BL:SWS|1->283|FDNH_SHIFL|e-166|93.3|283/294 241: + . . . . *: 300 :PKDPQIDTSINLWKGALKPLAAAGFIATFAGLIYHYIGIGPNKETDDDEEDHHE :Sequence :cccccccHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHcccc :Sec Str : XXXXXXXXXX :SEG|284->293|etdddeedhh :===== :RP:SCP|2->245|1kqfB1|2e-98|93.4|244/244|d.58.1.5 : ====================================== :RP:SCP|246->283|1kqfB2|2e-14|92.1|38/45|f.23.22.1 :=========================================== :BL:SWS|1->283|FDNH_SHIFL|e-166|93.3|283/294 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|246->283|PF09163|1e-11|68.4|38/44|Form-deh_trans