[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF66076.1 sent8 fdnH "formate dehydrogenase, nitrate-inducible, iron-sulfur subunit"
MSMETQDIIKRSATNAITPPPQARDYKAEVAKLIDVSSCVGCKACQVACSEWNDIRDNVG
HCVGVYDNPADLSAKSWTVMRFTETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQ
YANGIVDFQSEHCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCP
TGAIHFGTKKEMLELGEQRVEKLKARGFEHAGIYNPQGVGGTHVMYVLHHANQPELYHGL
PKDPQIDTSINLWKGALKPLAAAGFIATFAGLIYHYIGIGPNKETDDDEEDHHE
//