[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:glnS"

glnS        "glutaminyl-tRNA synthetase"
SYQ_SALTY   "RecName: Full=Glutaminyl-tRNA synthetase;         EC=6.1.1.18;AltName: Full=Glutamine--tRNA ligase;         Short=GlnRS;"

OrgPattern 11111111111111111111111111111111111111111111111111111111111111111111 1221-------------------------------------1---------------------1----1-1-1--------111111111111211-111111111-111---------------111-1---11-1--1------11111111111111-21111-1111-1111--1-1112111111--1-----------------1-------1----11-1111-12------------------1---1----1-----11--1111--1------------------------------------1----------1111-----------21111111-1---112-2212121-1-11111--212122-22222323333333333222222222222-22-22-21322-1221211121-1222322222222222111111111332211222221222122222112222212212222-1132212222222222222222222222222222121122111111111111212222222222222222322222222212222222222222222222111121221111111111111111111111112--222111222122222222222222122222112111122122222222222222222222-222222222222222222222222222221222222222222222222222312222222222221122111112222112112222222222222222221222111131111322223332122222222222222222222222223221222221112222221111------------1-21211---------------1----12-11211111-13 2222221-62222222222222232343322223332222222222222222222223222322222222222222212222222222-24222222222222223224243422352222222231326G2-2362222322222222222262222236E22233212322222222e2223234572344332223 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSEAEARPTNFIRQIIDEDLASGKHTTVHTRFPPEPNGYLHIGHAKSICLNFGIAQDYQG:Sequence : cHHHccTTcEEEEccccEccEEEEcccTTccccHHHHHHHHHHHHHHHHTTc:Sec Str : ############ :PROS|34->45|PS00178|AA_TRNA_LIGASE_I|PDOC00161| : ====================================================:RP:SCP|9->339|1euqA2|4e-45|97.6|331/331|c.26.1.1 :============================================================:BL:SWS|1->555|SYQ_SALTY|0.0|100.0|555/555 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->310|PF00749|6e-41|40.2|276/309|tRNA-synt_1c 61: . . . * . .: 120 :QCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHWSGDIRYSSDYFDQLHAYAVELINKGLA:Sequence :EEEEEEcccccccccHHHHHHHHHHHHHTTccccEEEEEGGGcHHHHHHHHHHHHHTTcE:Sec Str :============================================================:RP:SCP|9->339|1euqA2|4e-45|97.6|331/331|c.26.1.1 :============================================================:BL:SWS|1->555|SYQ_SALTY|0.0|100.0|555/555 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->310|PF00749|6e-41|40.2|276/309|tRNA-synt_1c 121: . . + . . .: 180 :YVDELTPEQIREYRGTLTAPGKNSPFRDRSVEENLALFEKMRTGGFEEGKACLRAKIDMA:Sequence :EEEcccHHHHHHHHHHHHHHTcccccccTTTTccEEEHHHHHHHHHHHHHHHHHTTcccc:Sec Str :============================================================:RP:SCP|9->339|1euqA2|4e-45|97.6|331/331|c.26.1.1 :============================================================:BL:SWS|1->555|SYQ_SALTY|0.0|100.0|555/555 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->310|PF00749|6e-41|40.2|276/309|tRNA-synt_1c 181: . * . . . .: 240 :SPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFTHCISDALEGITHSLCTLEFQDNRRL:Sequence :ccEEEETTEEEEEcccEETTEEcccEEEEEEEETcHHHHHHHHcGGGcccEEEEEEEEEE:Sec Str :============================================================:RP:SCP|9->339|1euqA2|4e-45|97.6|331/331|c.26.1.1 :============================================================:BL:SWS|1->555|SYQ_SALTY|0.0|100.0|555/555 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->310|PF00749|6e-41|40.2|276/309|tRNA-synt_1c 241: + . . . . *: 300 :YDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRR:Sequence :ETTEEEEEEcccccEEEEEEEEEccccTTcccEEccEEEEEEcccTTccccccEEcEEEE:Sec Str :============================================================:RP:SCP|9->339|1euqA2|4e-45|97.6|331/331|c.26.1.1 :============================================================:BL:SWS|1->555|SYQ_SALTY|0.0|100.0|555/555 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->310|PF00749|6e-41|40.2|276/309|tRNA-synt_1c 301: . . . . + .: 360 :GYTAASIREFCKRIGVTKQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYPQG:Sequence :EEEEEEEEcccGGGEEEEEEEEEEEEccccccHHHHHccEEEEEEEEEcccHHHHHHHHT:Sec Str :======================================= :RP:SCP|9->339|1euqA2|4e-45|97.6|331/331|c.26.1.1 : =====================:RP:SCP|340->549|1euqA1|4e-57|91.4|198/198|b.53.1.2 :============================================================:BL:SWS|1->555|SYQ_SALTY|0.0|100.0|555/555 :$$$$$$$$$$ :RP:PFM|28->310|PF00749|6e-41|40.2|276/309|tRNA-synt_1c : $$$$$$$$$$$$$$$$$$$$$:RP:PFM|340->529|PF03950|6e-63|64.3|185/186|tRNA-synt_1c_C 361: . . . * . .: 420 :ESEMVTMPNHPNKPEMGSREVPFSGEIWIDRADFREEANKQYKRLVMGKEVRLRNAYVIK:Sequence :cHHHHHHHHTTccccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccTTcccEEEE:Sec Str :============================================================:RP:SCP|340->549|1euqA1|4e-57|91.4|198/198|b.53.1.2 :============================================================:BL:SWS|1->555|SYQ_SALTY|0.0|100.0|555/555 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|340->529|PF03950|6e-63|64.3|185/186|tRNA-synt_1c_C 421: . . + . . .: 480 :AERVEKDAEGNITTIFCTYDADTLSKDPADGRKVKGVIHWVSAAHALPIEIRLYDRLFSV:Sequence :EEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHTcTTTTTcHHH:Sec Str :============================================================:RP:SCP|340->549|1euqA1|4e-57|91.4|198/198|b.53.1.2 :============================================================:BL:SWS|1->555|SYQ_SALTY|0.0|100.0|555/555 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|340->529|PF03950|6e-63|64.3|185/186|tRNA-synt_1c_C 481: . * . . . .: 540 :PNPGAAEDFLSVINPESLVIKQGYGEPSLKAAVAGKAFQFEREGYFCLDSRYATADKLVF:Sequence :HccTGGGHHHHHHHHHHccccTTcTTcccccEEEcccccccccHHHHHHHHTccccTTTc:Sec Str :============================================================:RP:SCP|340->549|1euqA1|4e-57|91.4|198/198|b.53.1.2 :============================================================:BL:SWS|1->555|SYQ_SALTY|0.0|100.0|555/555 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|340->529|PF03950|6e-63|64.3|185/186|tRNA-synt_1c_C 541: + . . . . *: 600 :NRTVGLRDTWAKAGE :Sequence :EEEEEccccc :Sec Str :========= :RP:SCP|340->549|1euqA1|4e-57|91.4|198/198|b.53.1.2 :=============== :BL:SWS|1->555|SYQ_SALTY|0.0|100.0|555/555