[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:gloA"

gloA        "lactoylglutathione lyase"
LGUL_SALTY  "RecName: Full=Lactoylglutathione lyase;         EC=4.4.1.5;AltName: Full=Methylglyoxalase;AltName: Full=Aldoketomutase;AltName: Full=Glyoxalase I;         Short=Glx I;AltName: Full=Ketone-aldehyde mutase;AltName: Full=S-D-lactoylglutathione methylglyoxal lyase;"

OrgPattern ------------------------21111111------------------------------------ ----------------------------------------------------------------------------------2---------------------------------------------------------------11111111-1111111111-11111111-1111--11--------1-111111-11-11---1-----11---------1111111---------------------1-------------------------1111---1111111111111111111111111111111111111-11-1---------------111---11--------------------11---1112-----231211112111122222122221-22122122111-2111221112111111121212222212222222223212111-----------------------------111211111111111111111111221111111121111-122113211111111111111111-1111111111211---------------------2-111111---------------------------11211221122211211112111111112122--11121------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111---1-----11111212111111111111111111111111111133231111211111111111-11111113321111133223111111111111111-1-11--------------------------------------------------21- ----112-21----1111111211111111111111121111111111131312212111111111111-111111111111111111-12111111111-11211--312333321-2--11221-213D2-22321--2-242221-12122-2122331-22222333113122216-1132546616211----2 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYN:Sequence :EEEEEEEEEEccHHHHHHHHTTTTcEEEEEccEEGGGTEEEcEEEEEcTTccEEEEEEEc:Sec Str : ###################### :PROS|5->26|PS00934|GLYOXALASE_I_1|PDOC00720| :============================================================:RP:SCP|1->128|1f9zA|5e-30|89.8|128/128|d.32.1.1 :============================================================:BL:SWS|1->135|LGUL_SALTY|3e-76|100.0|135/135 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|2->122|PF00903|3e-13|42.2|116/120|Glyoxalase 61: . . . * . .: 120 :WGVESYDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYK:Sequence :cTcccccccccEEEEEEEEccHHHHHHHHHTTcccccEEccEEEccccEEEEEEcTTccE:Sec Str : ############# :PROS|69->81|PS00935|GLYOXALASE_I_2|PDOC00720| :============================================================:RP:SCP|1->128|1f9zA|5e-30|89.8|128/128|d.32.1.1 :============================================================:BL:SWS|1->135|LGUL_SALTY|3e-76|100.0|135/135 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|2->122|PF00903|3e-13|42.2|116/120|Glyoxalase 121: . . + . . .: 180 :IELIEAKDAGRGLGN :Sequence :EEEEccccGGG :Sec Str :======== :RP:SCP|1->128|1f9zA|5e-30|89.8|128/128|d.32.1.1 :=============== :BL:SWS|1->135|LGUL_SALTY|3e-76|100.0|135/135 :$$ :RP:PFM|2->122|PF00903|3e-13|42.2|116/120|Glyoxalase