[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:glpB"

glpB        "glycerol-3-phosphate dehydrogenase, anaerobic, B subunit"
GLPB_SALTY  "RecName: Full=Anaerobic glycerol-3-phosphate dehydrogenase subunit B;         Short=Anaerobic G-3-P dehydrogenase subunit B;         Short=Anaerobic G3Pdhase B;         EC=1.1.5.3;"

OrgPattern ------------------------1--1111------------------------------------- ---------------------------------------------------------------1------------------------------------------------------------------------111-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------31-11----11-1----------------1---------------------------11-----------------------------------------1-1111-1111111111-111111111111111111111111--1111111111111111111111111--111111111111------------------1111-1111111111---------------------------------------111111111---11------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKFDTVIMGGGLAGLLCGLQLQQHGLRCAIVTRGQSALHFSSGSLDLLSALPDGQPVTDI:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXX :SEG|9->26|ggglagllcglqlqqhgl :============================================================:BL:SWS|1->419|GLPB_SALTY|0.0|100.0|419/419 61: . . . * . .: 120 :TAGLDALCRQAPEHPYSRLGAQKVLTLAQQAQTLLNASGAQLYGDVQQAHQRVTPLGTLR:Sequence : :Sec Str : XXXXXXXXXXXXXXXXX :SEG|81->97|aqkvltlaqqaqtllna :============================================================:BL:SWS|1->419|GLPB_SALTY|0.0|100.0|419/419 121: . . + . . .: 180 :STWLSSPEVPVWPLSAQRICVVGVSGLLDFQAHLAAASLRQRDLNVETAEIDLPELDVLR:Sequence : :Sec Str :============================================================:BL:SWS|1->419|GLPB_SALTY|0.0|100.0|419/419 181: . * . . . .: 240 :DNPTEFRAVNIARLLDNEEKWPLLYDALSPIATNCDMIIMPACFGLANDTLWRWLNERLP:Sequence : :Sec Str : XX:SEG|239->251|lpcaltllptlpp :============================================================:BL:SWS|1->419|GLPB_SALTY|0.0|100.0|419/419 241: + . . . . *: 300 :CALTLLPTLPPSVLGIRLHNQLQRQFVRQGGIWMPGDEVKKVTCRRGTVSEIWTRNHADI:Sequence : :Sec Str :XXXXXXXXXXX :SEG|239->251|lpcaltllptlpp :============================================================:BL:SWS|1->419|GLPB_SALTY|0.0|100.0|419/419 301: . . . . + .: 360 :PLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTATRAEWYQQHFFDPQPWQQFGV:Sequence : ccTTTcccccccccccccEEEEEEEccEEE:Sec Str : ==:RP:SCP|359->414|1d7yA1|3e-04|19.6|51/183|c.3.1.5 :============================================================:BL:SWS|1->419|GLPB_SALTY|0.0|100.0|419/419 361: . . . * . .: 420 :VTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGVCAVSALQAAHHIAERAGEQQ :Sequence :ccTTcEEEcTTccEEEEEEEccTTEEcccTTcccTTHHHHHHHHHHHHHHHHHHcHc :Sec Str :====================================================== :RP:SCP|359->414|1d7yA1|3e-04|19.6|51/183|c.3.1.5 :=========================================================== :BL:SWS|1->419|GLPB_SALTY|0.0|100.0|419/419