[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF69590.1 sent8 glpB "glycerol-3-phosphate dehydrogenase, anaerobic, B subunit"
MKFDTVIMGGGLAGLLCGLQLQQHGLRCAIVTRGQSALHFSSGSLDLLSALPDGQPVTDI
TAGLDALCRQAPEHPYSRLGAQKVLTLAQQAQTLLNASGAQLYGDVQQAHQRVTPLGTLR
STWLSSPEVPVWPLSAQRICVVGVSGLLDFQAHLAAASLRQRDLNVETAEIDLPELDVLR
DNPTEFRAVNIARLLDNEEKWPLLYDALSPIATNCDMIIMPACFGLANDTLWRWLNERLP
CALTLLPTLPPSVLGIRLHNQLQRQFVRQGGIWMPGDEVKKVTCRRGTVSEIWTRNHADI
PLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTATRAEWYQQHFFDPQPWQQFGV
VTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGVCAVSALQAAHHIAERAGEQQ
//