[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:mic"

mic         "transcriptional regulator Mic"
            ""

OrgPattern --1-1-----------11---------------------------11--------------111---- 243-A1111111111------2---3------1---1376-223277-61115461-61113644658B542333555-11-2-11-1223215-1---11----11313--------------1----1111112-1144111411111111--11---1-111112221------------311--45-312111111211111111343322111222-32133333257122111111122211112112-2-11-2---2211222211111121111322211222333333231122112111111312111322122-23111111131332221232112--322--11--1-511265521111112--------1------------11111111111-11-11--124--733653257621-----1--1111-21--------1--2---------------------------------------------------------1------------1---------------11----1-1------------------------------112121-1-1--11--1---------------------------342------12--------1111----1-1-------------43322324444444444-4444444444444444443444332223333333333333333532444432-444444424444-------------1----2221111----1222--------------------------1111---------22223333322222-----------------1111111---1-21-----------------------------2351133444-12 --------------------------------------------------------------------------------------------------------------3111121111--1132111391-114--11111111-11-111111111------------------------------------1-1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVADSQPGHIDQIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLV:Sequence :EEEEEccccHcccHHHHHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHTTcE:Sec Str : ==================================================:RP:SCP|11->78|1z05A1|5e-04|69.1|68/71|a.4.5.63 :============================================================:BL:SWS|1->406|MLC_ECOLI|0.0|89.4|406/406 61: . . . * . .: 120 :QELEIKEAGSRGRPAVGLMVETEAWHYLSIRISRGEIFLALRDLSSKLVVEECLPLPLTE:Sequence :EEccccEEEcccccEEcEEEccTTEEEEEEEEcccEEEEEEEETTccEEEEEEEEccccc:Sec Str : XXXXXXXXXX:SEG|111->126|eeclplplteatplle :================== :RP:SCP|11->78|1z05A1|5e-04|69.1|68/71|a.4.5.63 :============================================================:BL:SWS|1->406|MLC_ECOLI|0.0|89.4|406/406 121: . . + . . .: 180 :ATPLLERIITHVDRFFTRHQQKLERLTSIAITLPGIIDTENGVVHRMPYYEDVKEMPLGD:Sequence :cccHHHHHHHHHHHHHHHTTTTccEEEEEEEEEccEEETTTTEEEEcccccccccccTTT:Sec Str :XXXXXX :SEG|111->126|eeclplplteatplle : ==========================================:RP:SCP|139->211|1woqA1|2e-15|23.6|72/129|c.55.1.10 :============================================================:BL:SWS|1->406|MLC_ECOLI|0.0|89.4|406/406 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|142->274|PF00480|7e-28|43.9|132/181|ROK 181: . * . . . .: 240 :ALERHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVVIDHNVGAGVITDGHLLHAGSS:Sequence :HHHHTTcccEEEEEHHHHHHHHHHHccTTTTcccEEEEEEcccEEEEEEETTEEcccccc:Sec Str :=============================== :RP:SCP|139->211|1woqA1|2e-15|23.6|72/129|c.55.1.10 : ============================:RP:SCP|213->406|1z05A2|9e-29|41.2|194/197|c.55.1.10 :============================================================:BL:SWS|1->406|MLC_ECOLI|0.0|89.4|406/406 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|142->274|PF00480|7e-28|43.9|132/181|ROK 241: + . . . . *: 300 :SLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSVLELTQLRLNQSMSSMLHGQPLTVDSL:Sequence :ccccGGGccccccccccccccccccTTTccHHHHHHHHHTTTTTccccccccccccHHHH:Sec Str :============================================================:RP:SCP|213->406|1z05A2|9e-29|41.2|194/197|c.55.1.10 :============================================================:BL:SWS|1->406|MLC_ECOLI|0.0|89.4|406/406 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|142->274|PF00480|7e-28|43.9|132/181|ROK 301: . . . . + .: 360 :CQAAMQGDLLAKDIISGVGTHVGRILAIMVNLFNPQKILIGSPLSKAADILFPAIADSIR:Sequence :HHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcGGGGGHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|213->406|1z05A2|9e-29|41.2|194/197|c.55.1.10 :============================================================:BL:SWS|1->406|MLC_ECOLI|0.0|89.4|406/406 361: . . . * . .: 420 :QQALPAYSRNTVVESTQFTNQGTMAGAALVKDAMYNGSLLIRLLQG :Sequence :HHccHHHHTTccEEEccccTTcGGGGHHHHHHHHHccTTHHHHTTc :Sec Str :============================================== :RP:SCP|213->406|1z05A2|9e-29|41.2|194/197|c.55.1.10 :============================================== :BL:SWS|1->406|MLC_ECOLI|0.0|89.4|406/406