[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:nuoB"

nuoB        "NADH-quinone oxidoreductase, B subunit"
NUOB_SALTY  "RecName: Full=NADH-quinone oxidoreductase subunit B;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit B;AltName: Full=NDH-1 subunit B;"

OrgPattern 11313121222222213112222121111211212223222222132411233132232431121-11 22212---------12111-11--11111111111-11111111-1--1-----------22212112221--------21111111211111---1--1-11--22211--------------1111111111212222233321211211111111111111212111111111111111111111--1-1-111111111111111------111111----------11------------------------------------------------------------------------------------------1---1----------2-------1-1--2--112221----22--211--23-111111111212111112533311111111111-11111111111111113222212222111111222211122222222533-12231111111111111111111111111111111111-111111111111222211123233221131122111111111111221111111112111111111122211-1-2-1-442223-433132418333313-2122211111111111111111242333221---------------------1----11--211111111122222213332322233-3333322333323333333222211122222222222222222232222331-21111111111111111111111112--1-----1----------11111111111-1111111111111-1111111111111--------------11111111111111112-111111------------------------------------121111-11-251 ----111-211-1111121112222312212122221222122211-111223211222111111----1--111------11111---12111111111111112-1-32211111-------22-2-4J1-321----3--2------1--1--1-111-1111232121121111-----1123-41131134231 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDMVNWGRKNSIWPYNFG:Sequence :HHHHHHccHHHHHHHHHHHHHHHcccccc TTTHHTccTTcHHHHHHHTccEEEEEEccc:Sec Str : ==========================:RP:SCP|35->185|2fug61|7e-51|51.5|134/144|e.19.1.2 :============================================================:BL:SWS|1->220|NUOB_SALTY|e-131|100.0|220/220 61: . . . * . .: 120 :LSCCYVEMVTSFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEP:Sequence :ccHHHHHHHTccTTcHHHHHHTTcEEEHTcccccEEEEEccEEcTGGGHHHHHHHHGGGc:Sec Str :============================================================:RP:SCP|35->185|2fug61|7e-51|51.5|134/144|e.19.1.2 :============================================================:BL:SWS|1->220|NUOB_SALTY|e-131|100.0|220/220 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|64->172|PF01058|6e-20|46.3|108/128|Oxidored_q6 121: . . + . . .: 180 :KWVISMGACANSGGMYDIYSVVQGVDKFIPVDVYIPGCPPRPEAYMQALMLLQESIGKER:Sequence :cEEEEEcHHHHHcGGGcEEcHHHHHGGGTcccEEEccccccHHHHHHHHHHHHTTccccc:Sec Str : ################# :PROS|144->160|PS01150|COMPLEX1_20K|PDOC00858| :============================================================:RP:SCP|35->185|2fug61|7e-51|51.5|134/144|e.19.1.2 :============================================================:BL:SWS|1->220|NUOB_SALTY|e-131|100.0|220/220 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|64->172|PF01058|6e-20|46.3|108/128|Oxidored_q6 181: . * . . . .: 240 :RPLSWVVGDQGVYRANMQPERERKRGERIAVTNLRTPDEI :Sequence :cTTccHHHHcccHHHHcTTHHHHHTTccccccccHHHHT :Sec Str :===== :RP:SCP|35->185|2fug61|7e-51|51.5|134/144|e.19.1.2 :======================================== :BL:SWS|1->220|NUOB_SALTY|e-131|100.0|220/220