[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF67677.1 sent8 nuoB "NADH-quinone oxidoreductase, B subunit"
MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDMVNWGRKNSIWPYNFG
LSCCYVEMVTSFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEP
KWVISMGACANSGGMYDIYSVVQGVDKFIPVDVYIPGCPPRPEAYMQALMLLQESIGKER
RPLSWVVGDQGVYRANMQPERERKRGERIAVTNLRTPDEI
//