[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:nuoE"

nuoE        "NADH-quinone oxidoreductase, E subunit"
NUOE_SALTY  "RecName: Full=NADH-quinone oxidoreductase subunit E;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit E;AltName: Full=NDH-1 subunit E;"

OrgPattern -----------------------------1----1---------1--1----------1-1------- 11211---------11111-11--12111111211111111111-1--1-----------11111111111----------1-11112--1--1-----1-11--21111--------------1-----1---1-22222444111111111--11------11--11--------------1111133---------------------------------------------------------------1---------------------------------------------------------------------144-1111111111121------2-2112--23113436331211121--3--111111111232221123333311111111111-22222222121122223332223322111222333321111111111322-22111111111111111111111111111111111221-22212222122222221111222222112223311111321112112222221222111111111113122131-2-1--3-----343243265111111641--1---------------------11112---2-----------------1----11--211111111111111111111111111-1111111111111111111111111111111111111111111111111111-1111111-1-1111111111111113-111---------------11111111111-1111221122222-1111111111111--------------11111111111111111-111111------------------------------------3223333233221 ----111-211-11111111111111-111111111111111111111111111111111-1111----1--111------11111---12111111111111112-111211111111111111113-3A1-3121-111113111-111111-11111111111221251111111171111121321111121111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MHENQQPQTEAFELSAAEREAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIAD:Sequence : TccTTcGGGGHHHHHHHHHHHHccccHHHHHHHHH:Sec Str : ===============================================:RP:SCP|14->162|2fug21|6e-35|29.5|149/178|c.47.1.21 :============================================================:BL:SWS|1->166|NUOE_SALTY|7e-98|100.0|166/166 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|29->165|PF01257|2e-33|46.0|137/142|Complex1_24kDa 61: . . . * . .: 120 :VLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQT:Sequence :HHTccHHHHHHHHTTcccccccccccccEEccccHHHHTTTHHHHHHHHHHHHccccccc:Sec Str :============================================================:RP:SCP|14->162|2fug21|6e-35|29.5|149/178|c.47.1.21 :============================================================:BL:SWS|1->166|NUOE_SALTY|7e-98|100.0|166/166 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|29->165|PF01257|2e-33|46.0|137/142|Complex1_24kDa 121: . . + . . .: 180 :TFDGRFTLLPTCCLGNCDKGPNMMIDEDTHSHLTPEAIPELLERYK :Sequence :cccccccccccccccccTTccccEEGGGccccccccHHHHHHHHc :Sec Str : ################### :PROS|123->141|PS01099|COMPLEX1_24K|PDOC00843| :========================================== :RP:SCP|14->162|2fug21|6e-35|29.5|149/178|c.47.1.21 :============================================== :BL:SWS|1->166|NUOE_SALTY|7e-98|100.0|166/166 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|29->165|PF01257|2e-33|46.0|137/142|Complex1_24kDa