[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF68005.1 sent8 nuoE "NADH-quinone oxidoreductase, E subunit"
MHENQQPQTEAFELSAAEREAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIAD
VLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQT
TFDGRFTLLPTCCLGNCDKGPNMMIDEDTHSHLTPEAIPELLERYK
//