[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:panB"

panB        "3-methyl-2-oxobutanoate hydroxymethyltransferase"
PANB_SALTY  "RecName: Full=3-methyl-2-oxobutanoate hydroxymethyltransferase;         EC=2.1.2.11;AltName: Full=Ketopantoate hydroxymethyltransferase;         Short=KPHMT;"

OrgPattern 1111111111111111-111111-1111-111----------------------1111111-----11 11-1111111111111111-111111111111111111111111111-111111111111111-1111111---------1--1111111111111---11121111111---------------111111111111111111111111111111111111111111111111111111111111111---111111111111111111111111111111111111111111-11111111111111111111---------------------------------------------------------------------11-111111111-1111111-----1----111111211--1111-11---11111111111113-11111111111111111111-11111211131-211122222222111111-1111111111111111111-111111---------------------------111112-111121222211111111111111121111111111112111111111111111111111111111111111111111111111-111111111111111111111111111-11111111111111111111111111112222111111111111111--11111--11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---111111111111211---------------1112111111212222221111211111111111111111211111111111111111111111111111-111111------------------------------------11-1111111111 ----111-----22111111111212111111111111111111111111111111111111111111-1111111111111111111-12112111111111111-111---------------------------------------------------------------1-1111I111111--31331121222 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKPTTISLLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVGDSLGMTIQGHDSTLPV:Sequence :HHHHHHHHHHHHHHHcccEEEEcccEEEEcccHHHHHHHHHHHHHHHHHHcHHHHHHHHH:Sec Str : ==========================================================:RP:SCP|3->263|1m3uA|2e-41|85.4|261/262|c.1.12.8 :============================================================:BL:SWS|1->263|PANB_SALTY|e-138|100.0|263/263 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|2->259|PF02548|4e-77|54.3|258/261|Pantoate_transf 61: . . . * . .: 120 :TVEDIAYHTRAVRRGAPNCLLLSDLPFMAYATPEQACENAAIVMRAGANMVKIEGGAWLV:Sequence :HHcHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHHTccTTcccEEEEEETTEEHHHHHHTc:Sec Str :============================================================:RP:SCP|3->263|1m3uA|2e-41|85.4|261/262|c.1.12.8 :============================================================:BL:SWS|1->263|PANB_SALTY|e-138|100.0|263/263 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|2->259|PF02548|4e-77|54.3|258/261|Pantoate_transf 121: . . + . . .: 180 :DTVKMLTERAVPVCGHLGLTPQSVNIFGGYKIQGRGDAGQVLLDDALALEAAGAQLLVLE:Sequence :TTcccHHHHHHTcTTTHHHHHHHTTccGGGcccccccTTccccHHHHHHHHHTTcTTTcc:Sec Str : XXXXXXXXXXXXXXXXXXXXX:SEG|160->180|qvllddalaleaagaqllvle :============================================================:RP:SCP|3->263|1m3uA|2e-41|85.4|261/262|c.1.12.8 :============================================================:BL:SWS|1->263|PANB_SALTY|e-138|100.0|263/263 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|2->259|PF02548|4e-77|54.3|258/261|Pantoate_transf 181: . * . . . .: 240 :CVPVELAKRVTEALSIPVIGIGAGNVTDGQILVMHDAFGITGGHIPKFAKNFLAEAGDMR:Sequence :cGGGTTTHHHHHHTTccccHHHHHHHHHcTTccHHHHHHHHTccHHHHHcccccccccHH:Sec Str :============================================================:RP:SCP|3->263|1m3uA|2e-41|85.4|261/262|c.1.12.8 :============================================================:BL:SWS|1->263|PANB_SALTY|e-138|100.0|263/263 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|2->259|PF02548|4e-77|54.3|258/261|Pantoate_transf 241: + . . . . *: 300 :AAVQQYMAEVESGVYPGEEHSFH :Sequence :HHHHHHHTTccccHHHHHHHHHH :Sec Str :======================= :RP:SCP|3->263|1m3uA|2e-41|85.4|261/262|c.1.12.8 :======================= :BL:SWS|1->263|PANB_SALTY|e-138|100.0|263/263 :$$$$$$$$$$$$$$$$$$$ :RP:PFM|2->259|PF02548|4e-77|54.3|258/261|Pantoate_transf