[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:panE.2"

panE        "2-dehydropantoate 2-reductase"
            ""

OrgPattern --1--------------11----11--1-1--11----1-1-11-12-------1111111------- -------1111---111--------1-------------1--------------1-------------1---111--------1-111---1-1---------1---1----------------------------32212------------22----------------------------1-------1-211111111-111111-11111-11112--1-------21111111111111111211123-1-11-2-1-3222--11-22-1111111111--------------1111111111111-111111111---211111111111-1111111---11-1-2-5311-1-----------1211---------14111-232332------------11111311-1--1---1--11----------1--11--1---------21---11-------------------------------31--22111422224111114423111111121-221-2211-1111225-3211---1-------------11----11-1--------222-111-------1-2---------------------------11121-1-1--111111111111111-1111------------11121-11111111111-11111111111111111111211-1112122222222222222111111111-111111111111---1---------1-1-----------------------------1111121-1212111-1----------11111111111111----------------------------------------------------------------------111 ----11------11--111-2312132--------1-----------1--1-111-1------12-1311-12111----211-22-1----1-----------11----------------------------------------------------------------------------------22-----1--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKIAIAGAGAMGCRFGYMLLEAGHDVTLIDGWQEHVDAIRSKGLFVETETTQKYYPIPAM:Sequence :cEEEEEcccHHHHHHHHHHHTTTcEEEEEcccHHHHHHHHHHcEEEEETTEEEEEccEEE:Sec Str : XXXXXXXX :SEG|3->10|iaiagaga :============================================================:RP:SCP|1->175|1txgA2|4e-07|11.4|175/180|c.2.1.6 : ==================================================:BL:SWS|11->303|PANE_LACLA|2e-67|45.4|293/312 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->147|PF02558|5e-18|36.7|128/150|ApbA 61: . . . * . .: 120 :LADESQGEFELVILFTKAMQLDSMLQRIKPLLPAAKVVMILSNGLGNIETLEKYVDRQKI:Sequence :ccccccccEcEEEEcccGGGHHHHHHHHHTccccEEEEcccccHHHHHHHHHTcccccEE:Sec Str :============================================================:RP:SCP|1->175|1txgA2|4e-07|11.4|175/180|c.2.1.6 :============================================================:BL:SWS|11->303|PANE_LACLA|2e-67|45.4|293/312 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->147|PF02558|5e-18|36.7|128/150|ApbA 121: . . + . . .: 180 :YAGVTLWSSELEGAGHIMATGTGTIELQPIASQDSAQEAKVIATLNSAGLNAEISPDVLL:Sequence :EEEEEccEEEEccccEEEEEEcccEEEEEcTTccGTHHHHHHHccccTTccEEEcccHHH:Sec Str :======================================================= :RP:SCP|1->175|1txgA2|4e-07|11.4|175/180|c.2.1.6 :============================================================:BL:SWS|11->303|PANE_LACLA|2e-67|45.4|293/312 :$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|19->147|PF02558|5e-18|36.7|128/150|ApbA : $$$$:RP:PFM|177->303|PF08546|3e-18|36.8|125/125|ApbA_C 181: . * . . . .: 240 :SIWKKAAFNSVMNTYCALLDCNVGGFGQRPGALDLAQAVVDEFVLVAASQNIPLTEQMVM:Sequence :HHHHHHHHHHHHHHHHHHHTccTTHHHHcHHHHHHHHHHHHHHHHHHTcccHHHHHHHHH:Sec Str : ====================================================:RP:SCP|189->305|1bg6A1|2e-15|15.4|117/165|a.100.1.5 :============================================================:BL:SWS|11->303|PANE_LACLA|2e-67|45.4|293/312 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|177->303|PF08546|3e-18|36.8|125/125|ApbA_C 241: + . . . . *: 300 :NTVKKVFDPRESGHHYPSMHQDLHKGRLTEIDYLNGAIARIGAQNNIAVPVNKLLTQLIH:Sequence :HHHHHTTHHHHHHTcccHHHHHHTTTccccHHHHHHHHHHHHHHTTcccHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|189->305|1bg6A1|2e-15|15.4|117/165|a.100.1.5 :============================================================:BL:SWS|11->303|PANE_LACLA|2e-67|45.4|293/312 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|177->303|PF08546|3e-18|36.8|125/125|ApbA_C 301: . . . . + .: 360 :AKEAQ :Sequence :HHcTc :Sec Str :===== :RP:SCP|189->305|1bg6A1|2e-15|15.4|117/165|a.100.1.5 :=== :BL:SWS|11->303|PANE_LACLA|2e-67|45.4|293/312 :$$$ :RP:PFM|177->303|PF08546|3e-18|36.8|125/125|ApbA_C