[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:rplY"

rplY        "ribosomal L25p family"
RL25_SALTY  "RecName: Full=50S ribosomal protein L25;"

OrgPattern -------------------------------------------------------------------- ----------------------------------------------1--------1------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1------111111------------11111111111---------111-111111111111--1---1111111----------------1-11--1-------1111111111111-----11111111111111111111111111111111111111111111111111111111111111-1111111111111-----------------------------------------------------------1111111111111111111111111111111-111-111-11111111111111111-11-1111111111111111111111111111111111111111111111111111-111111111111-1111111111111111111111111111111111111111111111111-11111111---111111111111111111111111111111111-111111--------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEV:Sequence :ccEEEcEEcccccHHHHHHHHHTTEEEEEEEccccccEEEEEEHHHHHHHTTcGGGGTcc:Sec Str :============================================================:RP:SCP|1->94|1dfuP|1e-31|91.5|94/94|b.53.1.1 :============================================================:BL:SWS|1->94|RL25_SALTY|9e-50|100.0|94/94 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->91|PF01386|1e-21|54.5|88/88|Ribosomal_L25p 61: . . . * . .: 120 :LTLVVDGKEVKVKAQAVQRHAYKPKLTHIDFVRA :Sequence :cEEEETTEEccEEEEEEEEccccccEEEEEEEEc :Sec Str :================================== :RP:SCP|1->94|1dfuP|1e-31|91.5|94/94|b.53.1.1 :================================== :BL:SWS|1->94|RL25_SALTY|9e-50|100.0|94/94 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|4->91|PF01386|1e-21|54.5|88/88|Ribosomal_L25p