[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:trmU"

trmU        "tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
MNMA_SALTI  "RecName: Full=tRNA-specific 2-thiouridylase mnmA;         EC=2.8.1.-;"

OrgPattern -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111-------111111111133331111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112211111111111111111111121111111111111111111111111111111---1111111111111111111111111111111111111111111111111111222222212111111111121111111111111111112221122121111111111111111111111111111111111-111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111212111111111111212111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111121111111111111111111111111111111111111111111111111111111111211111111111111111111111-111111-11111111111111111111111111111111 ----111-311---1-----------------------------------------------11111111111111111111111111-111-11111111-1111-22122111121111-1112-318B1-312111-311111111-11-2122121--1211-114A11-32112I222223121-11222121- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSESPKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQA:Sequence : cccEEEEEccccHHHHHHHHHHHHHccEEEEEccccccccccHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXXX :SEG|8->21|vivgmsggvdssvs : XXXXXXXXXX:SEG|51->60|aaadladaqa : =======================================:RP:SCP|22->283|1xngA1|2e-30|18.3|208/255|c.26.2.1 :============================================================:BL:SWS|1->368|MNMA_SALTI|0.0|100.0|368/368 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|22->360|PF03054|e-125|64.7|331/348|tRNA_Me_trans 61: . . . * . .: 120 :VCDKLGIELHTVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLG:Sequence :HHHHHTcccccccTHHHHHHHTHHHHHHHHHTTccccTHHHHHHHTTTTHHHHHHHTTcc:Sec Str :============================================================:RP:SCP|22->283|1xngA1|2e-30|18.3|208/255|c.26.2.1 :============================================================:BL:SWS|1->368|MNMA_SALTI|0.0|100.0|368/368 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|22->360|PF03054|e-125|64.7|331/348|tRNA_Me_trans 121: . . + . . .: 180 :ADYIATGHYVRRADVNGKSRLLRGLDGNKDQSYFLYTLGHEQIAQSLFPVGELEKPQVRK:Sequence :ccEEEcccccEEEEETTEEEEEccccGGGccGGGGGcccTHHHHHEEccGGGccHHHHHH:Sec Str :============================================================:RP:SCP|22->283|1xngA1|2e-30|18.3|208/255|c.26.2.1 :============================================================:BL:SWS|1->368|MNMA_SALTI|0.0|100.0|368/368 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|22->360|PF03054|e-125|64.7|331/348|tRNA_Me_trans 181: . * . . . .: 240 :IAEDLGLVTAKKKDSTGICFIGERKFRDFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTL:Sequence :HHHHHTcTTcccccccccTTcccccHHHHHTTTccccccccccTTccccccccccTTccT:Sec Str :============================================================:RP:SCP|22->283|1xngA1|2e-30|18.3|208/255|c.26.2.1 :============================================================:BL:SWS|1->368|MNMA_SALTI|0.0|100.0|368/368 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|22->360|PF03054|e-125|64.7|331/348|tRNA_Me_trans 241: + . . . . *: 300 :GQRKGLGIGGTKDGSEDPWYVVDKDVENNVLIVAQGHEHPRLMSVGLIAQQLHWVDREPF:Sequence :TcccccccccccccccccEEEEEccTTTTccEEEEcTTcGGGEEEEEEEEccccTTcccc:Sec Str :=========================================== :RP:SCP|22->283|1xngA1|2e-30|18.3|208/255|c.26.2.1 :============================================================:BL:SWS|1->368|MNMA_SALTI|0.0|100.0|368/368 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|22->360|PF03054|e-125|64.7|331/348|tRNA_Me_trans 301: . . . . + .: 360 :TGTLRCTVKTRYRQTDIPCTINALDDDRIEVIFDEPVAAVTPGQSAVFYSGEVCLGGGII:Sequence :ccEEEEEEEccTTcccEEEEEEccccccEEEEEEEEEETccTTcEEEEEETTEEEEEEEE:Sec Str : ############ :PROS|347->358|PS00070|ALDEHYDE_DEHYDR_CYS|PDOC00068| :============================================================:BL:SWS|1->368|MNMA_SALTI|0.0|100.0|368/368 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|22->360|PF03054|e-125|64.7|331/348|tRNA_Me_trans 361: . . . * . .: 420 :EQRLPLTV :Sequence :EEEEEccc :Sec Str :======== :BL:SWS|1->368|MNMA_SALTI|0.0|100.0|368/368