[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF54773.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1111--11111--111---1---1---111211------------------------2--------22----111-1-1111111111111-1-11-11-1111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MADGSGKLAEGGTKLTSGLEDLQTGLASLGQGLGNASDQLKSVSTESKNAEILSNPLNLS:Sequence : =========================================================:BL:SWS|4->112|YHGE_BACSU|4e-07|22.0|109/100 61: . . . * . .: 120 :KTDNDQVPVNGIAIAPYMISVALFFAAISTNMIFAKLPSGRHPESRWAWLKS :Sequence :==================================================== :BL:SWS|4->112|YHGE_BACSU|4e-07|22.0|109/100