[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF54777.1"

            "putative acyltransferase"
            ""

OrgPattern -------------------------------------------------------------------- -----11----131-----------------------------1---------------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111-----1-1-11----111111121-11----1111-111111111111111111111112111111121111111--------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRIKWFSLVRITGLLLVLLYHFFQTIFPGGFFGVDVFFTFSGFLITALLIEEFSKNHEID:Sequence : :Sec Str : XXXXXX :SEG|14->19|lllvll : XXXXXXXXXXXXXXXXX :SEG|27->43|fpggffgvdvfftfsgf : =================:BL:SWS|44->215,433->596|OATA_STAAW|3e-16|29.3|310/603 61: . . . * . .: 120 :LIGFFRRRFYRIVPPVVLMVLVTMPFTFLVRQDYVAGIGGQIASVLGFMTNFYELLTGGS:Sequence : :Sec Str : XXXXXXXXXXXXX :SEG|73->85|vppvvlmvlvtmp :============================================================:BL:SWS|44->215,433->596|OATA_STAAW|3e-16|29.3|310/603 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|61->216|PF01757|8e-06|28.4|141/343|Acyl_transf_3 121: . . + . . .: 180 :YESQFIPHLFVHNWSLAVEVHYYILWGLAVWFLSKQAKSNGQLKGMVFLLSAVAFLISFF:Sequence : :Sec Str :============================================================:BL:SWS|44->215,433->596|OATA_STAAW|3e-16|29.3|310/603 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|61->216|PF01757|8e-06|28.4|141/343|Acyl_transf_3 181: . * . . . .: 240 :SMFIGSFLVTSYSSVYFSSLTHVYPFFLGSMLATIVGVRQTTSLVKQLDKIWDLRKTLVV:Sequence : :Sec Str : XXXXX:SEG|236->258|ktlvvfgggfgflvlltffvkft :=================================== :BL:SWS|44->215,433->596|OATA_STAAW|3e-16|29.3|310/603 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|61->216|PF01757|8e-06|28.4|141/343|Acyl_transf_3 241: + . . . . *: 300 :FGGGFGFLVLLTFFVKFTYLFAYLIGFLLASLAALAMILAARVLHEKTHHIQEPKIISFL:Sequence : :Sec Str :XXXXXXXXXXXXXXXXXX :SEG|236->258|ktlvvfgggfgflvlltffvkft : XXXXXXXXXXXXXXXXX :SEG|268->284|llaslaalamilaarvl 301: . . . . + .: 360 :ADTSYAVYLFHWPFYIIFSQLTSNLLAVLLTLICSYGFASLSFYVLEPWIAGKNTPIVQT:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|321->332|ltsnllavlltl 361: . . . * . .: 420 :LRPLPYIHAILAAGTGILTIIVCTVTLLAPQVGAFETDLTVNGLKQAATNIGQTKVMAER:Sequence : ccccccccHHHHHHHHHHHH:Sec Str 421: . . + . . .: 480 :ADANSLGIADGTMLIGDSVALRANTALQTALPGAQINAQVSVTTKTANEIMLNNSQNKFL:Sequence :HHHccccE EEEEcHHHHHTcHHHHHHTGGGcEEEEcTccHHHHHHHHHTTTTTTcc:Sec Str : ===========================================================:RP:SCP|422->597|1yzfA1|7e-09|15.9|170/195|c.23.10.5 : ================================================:BL:SWS|44->215,433->596|OATA_STAAW|3e-16|29.3|310/603 481: . * . . . .: 540 :PKTVVIATGVNNPENYKDDWDSIVKNLPKGHHMILVTPYEGDKTKETYAIVEKAAAYMRE:Sequence :ccEEEEEccTTcHHHHHHHHHHHHHHcTTcEEEEEccccccccccHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|422->597|1yzfA1|7e-09|15.9|170/195|c.23.10.5 :============================================================:BL:SWS|44->215,433->596|OATA_STAAW|3e-16|29.3|310/603 541: + . . . . *: 600 :LAEKTPYITIADWNQVAKEHPEIWAGTDQVHFGSESSTIEAGAKLYADTIATALQTAQDK:Sequence :HHTTcTTEEEEccccccccTTcccccTTccccc HHHHHHHHHHHHHHH :Sec Str :========================================================= :RP:SCP|422->597|1yzfA1|7e-09|15.9|170/195|c.23.10.5 :======================================================== :BL:SWS|44->215,433->596|OATA_STAAW|3e-16|29.3|310/603 601: . . . . + .: 660 :PVKSK :Sequence : :Sec Str