[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF54781.1"

            "bacteriocin-associated integral membrane protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------2121--33334233322--------------32---222----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKRLFILISMVLVSLYMVITSVDHREEILFGNYPSVDVTGMMTNQPVASREEVTEALSHL:Sequence 61: . . . * . .: 120 :AVEHNSLIARRIVEPNEAGETRFTYATYGEGELPEGLTISSKESAETSDLLGSYLIVSGS:Sequence 121: . . + . . .: 180 :LDGVSLQTTLKELGYQGFVSNGEDPFSIVLLLTATPMVLLSLAIFLLTFMSLTLIYRIKS:Sequence 181: . * . . . .: 240 :LRQAGIRLIAGESLFGVALRPVLEDVRQLICSVLVSSLLGLGILWYQGALFMATVQLVII:Sequence : XXXXXXXXXXXXXXXX :SEG|209->224|licsvlvssllglgil 241: + . . . . *: 300 :ALLLYGLTLAGISTLLSVVHLLGLQENSLVDLLKGKLPLKRMMTLMMVGQLLAVLVVGSS:Sequence 301: . . . . + .: 360 :ATALLPHYREMQEMERASNKWSQSSDRYRLSFGWSSAFADEEGTRKDNREWQTFTEERLA:Sequence 361: . . . * . .: 420 :NTDSFYIMSNVDNFSDGAEVDLDGNRLSDYTPSGNVIYVSPRYLIEEKITVSSEFMDKMQ:Sequence : ==================================:BL:SWS|387->479|SYP_HALMA|7e-04|33.7|86/100 421: . . + . . .: 480 :NLSEGEFGLILPESLREQSVYYQGLFTDYLQNFSSESVEVTSQKHYLPQVRLAFTETGQE:Sequence :=========================================================== :BL:SWS|387->479|SYP_HALMA|7e-04|33.7|86/100 481: . * . . . .: 540 :RFLYNDGYKTTRQYLKDPIIVVLTPQATGTRPVAGMLWGTTANSALKLDRYGDSITALKE:Sequence 541: + . . . . *: 600 :QGLYHKVSYLVKSQLFFAKVLNDKRVEFYSLLIGTILTLSTAILLFDSMNLLYFEQFRRE:Sequence : XXXXXXXXXXXXXXX :SEG|571->585|lligtiltlstaill : $$$$$$$$$$$$$$$:RP:PFM|586->675|PF07242|1e-13|45.6|90/100|DUF1430 601: . . . . + .: 660 :LMIKRLAGMTIYELHGKYLLAQGGVLLLGLVLSSILTRDGLISALVVALFTLNALLILVR:Sequence : XXXXXXXXXXXXXX :SEG|619->632|llaqggvlllglvl :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|586->675|PF07242|1e-13|45.6|90/100|DUF1430 661: . . . * . .: 720 :QDKKEEAGSMAVLKGK :Sequence :$$$$$$$$$$$$$$$ :RP:PFM|586->675|PF07242|1e-13|45.6|90/100|DUF1430