[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF54781.1 spne4 ACF54781.1 "bacteriocin-associated integral membrane protein"
MKRLFILISMVLVSLYMVITSVDHREEILFGNYPSVDVTGMMTNQPVASREEVTEALSHL
AVEHNSLIARRIVEPNEAGETRFTYATYGEGELPEGLTISSKESAETSDLLGSYLIVSGS
LDGVSLQTTLKELGYQGFVSNGEDPFSIVLLLTATPMVLLSLAIFLLTFMSLTLIYRIKS
LRQAGIRLIAGESLFGVALRPVLEDVRQLICSVLVSSLLGLGILWYQGALFMATVQLVII
ALLLYGLTLAGISTLLSVVHLLGLQENSLVDLLKGKLPLKRMMTLMMVGQLLAVLVVGSS
ATALLPHYREMQEMERASNKWSQSSDRYRLSFGWSSAFADEEGTRKDNREWQTFTEERLA
NTDSFYIMSNVDNFSDGAEVDLDGNRLSDYTPSGNVIYVSPRYLIEEKITVSSEFMDKMQ
NLSEGEFGLILPESLREQSVYYQGLFTDYLQNFSSESVEVTSQKHYLPQVRLAFTETGQE
RFLYNDGYKTTRQYLKDPIIVVLTPQATGTRPVAGMLWGTTANSALKLDRYGDSITALKE
QGLYHKVSYLVKSQLFFAKVLNDKRVEFYSLLIGTILTLSTAILLFDSMNLLYFEQFRRE
LMIKRLAGMTIYELHGKYLLAQGGVLLLGLVLSSILTRDGLISALVVALFTLNALLILVR
QDKKEEAGSMAVLKGK
//