[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF54833.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -------------1--------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111--11111111111-------------1-----------1-------------1--1----1-----1------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKSRKLATLGICSALFLGLAACQQQHATSEGTNQRQSSSAKVPWKASYTNLNNQVSTEE:Sequence : ==:BL:SWS|59->169|SP6D_BACSU|1e-04|34.3|108/575 61: . . . * . .: 120 :VKSLLSAHLDPNSVDAFFNLVNDYNTIVGSTGLSGDFTSFTHTEYDVEKISHLWNQKKGD:Sequence :============================================================:BL:SWS|59->169|SP6D_BACSU|1e-04|34.3|108/575 121: . . + . . .: 180 :FVGTNCRINSYCLLKNSVTIPKLEKNDQLLFLDNDAIDKGKVFDSQDKEEFDILFSRVPT:Sequence : =====================================:RP:SCP|144->258|1bqqT|7e-04|16.4|110/184|b.40.3.1 :================================================= :BL:SWS|59->169|SP6D_BACSU|1e-04|34.3|108/575 : ================================:BL:SWS|149->265|HEM1_CHLAB|5e-04|30.6|111/100 181: . * . . . .: 240 :EATTDVKVHAEKMETFFSQFQFNEKARMLSVVLHDNLDGEYLFVGHVGVLVPTDDGFLFV:Sequence :============================================================:RP:SCP|144->258|1bqqT|7e-04|16.4|110/184|b.40.3.1 :============================================================:BL:SWS|149->265|HEM1_CHLAB|5e-04|30.6|111/100 241: + . . . . *: 300 :EKLTFEEPYQAIKFASKEDCYKYLGTKYADYTGEGLAKPFIMDNDKWVKL :Sequence :================== :RP:SCP|144->258|1bqqT|7e-04|16.4|110/184|b.40.3.1 :========================= :BL:SWS|149->265|HEM1_CHLAB|5e-04|30.6|111/100