[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF54875.1"

            "glycosyl hydrolase family protein"
            ""

OrgPattern -------------------------------------------------------------------- 2-2-1----------------------------------1----131-111-111--1-----11--2---2222111----------2221-2-----------1-1-1-----------------------------22---------------------------------------------1111-1------------------1--------11--1--------3---------------------11-22-11-1211124112-11----1------1111122121111-------------222---222-1---2---------------2112--2---3------------11-1--1-------------------------------------------------1--1--------------1-----11-----------------------------------------------11-----------1-----------111---------------1---------------------------------------------------------------------------------------------1-----1-1---------------------------------111-1---------1------1--------------11111------------------------------11111111111-----------------1-----1-------------------1----------------------------111--1--111-12------------------111111--------1---------------------------1111111111--1 ---------------111132222123---------------------1123121-------------------------------------1----------232---------------------------------------------------------------------1---------1---1--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTIYINKDETVFHLAMKDSSYIFRILENGELQHLHFGKRIHVKENYNQLMAYEKRGFEVS:Sequence : :Sec Str : ==========================================================:BL:SWS|3->709|AGAL1_PEDPE|e-161|41.2|704/733 61: . . . * . .: 120 :FSEEFEDIQQSMIQNEYSSYGKGDFRHPAFQVQGMNGSRITTLKYQDFELEKGKNRLNSL:Sequence : :Sec Str :============================================================:BL:SWS|3->709|AGAL1_PEDPE|e-161|41.2|704/733 121: . . + . . .: 180 :PSTFDDIGQCAETLTIILTDSILDLTVRLNYTIFPEYNVLVRNTEFLNNSNNKLTLLKAM:Sequence : :Sec Str : XXXXXXXXXXXXXX :SEG|133->146|tltiiltdsildlt : XXXXXXXXXXXX :SEG|167->178|lnnsnnkltllk :============================================================:BL:SWS|3->709|AGAL1_PEDPE|e-161|41.2|704/733 181: . * . . . .: 240 :SLQLDLPDSQYDFIQFSGAWLRERQLYRTSLRPGIQAIDSLRYSSSPQQNPFFMLSRRET:Sequence : cccGGGccEEEEcGGG:Sec Str : ==================:RP:SCP|223->308|1dhrA|3e-04|5.8|86/236|c.2.1.2 :============================================================:BL:SWS|3->709|AGAL1_PEDPE|e-161|41.2|704/733 241: + . . . . *: 300 :TEHSGEVYGFNFIYSGNFQNMIEVDHFDTARVTVGINPVEFRFLLNPAESFVTPEAIVIY:Sequence :ccEcccccccccTTcccccccccHHHHHHHHHHHTccEEEEEHccHHHccTTccHHHHHH:Sec Str :============================================================:RP:SCP|223->308|1dhrA|3e-04|5.8|86/236|c.2.1.2 :============================================================:BL:SWS|3->709|AGAL1_PEDPE|e-161|41.2|704/733 301: . . . . + .: 360 :SDQGMNQMSQQLSDFYRHHLVNPNFSQASRPIILNSWETFYFDLGTEKILDLAKAAKDLG:Sequence :HHHHHHHHHHHHcccccEEEccccccGGGTTccTTcccHHHHHHHHHHHHHHHHHHHHHT:Sec Str :======== :RP:SCP|223->308|1dhrA|3e-04|5.8|86/236|c.2.1.2 : ========================================================:RP:SCP|305->642|1bhwA|4e-25|14.2|318/392|c.1.15.3 :============================================================:BL:SWS|3->709|AGAL1_PEDPE|e-161|41.2|704/733 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|331->557|PF02065|3e-67|61.3|204/225|Melibiase 361: . . . * . .: 420 :IELFVLDDGWFGHRKDDKSSLGDWVTDRSRLPEGIGFLADEIHKIGLQFGLWFEPEMISI:Sequence :ccEEEEcccEcTTcEEccTTcccHHHHHHHHHHHHHHHHHHHHHHTcccEEEEEcccccc:Sec Str :============================================================:RP:SCP|305->642|1bhwA|4e-25|14.2|318/392|c.1.15.3 :============================================================:BL:SWS|3->709|AGAL1_PEDPE|e-161|41.2|704/733 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|331->557|PF02065|3e-67|61.3|204/225|Melibiase 421: . . + . . .: 480 :DSDLYKNHADWTIHLLDREKSVGRNQYVLDLTRQEVVDYLFDSISKIIIKTNLDYIKWDM:Sequence :ccEEccccHHHHHHHHTTcTTGGGEEEcccHHHHHTTTccHHHHHHHTTTTcHHHHHHTT:Sec Str :============================================================:RP:SCP|305->642|1bhwA|4e-25|14.2|318/392|c.1.15.3 :============================================================:BL:SWS|3->709|AGAL1_PEDPE|e-161|41.2|704/733 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|331->557|PF02065|3e-67|61.3|204/225|Melibiase 481: . * . . . .: 540 :NRHITDIYSIELDSEQQMEFGHRYILGLYQLLDRLITKFPSVLFESCSSGGGRFDLGLMY:Sequence :cccccEEcccccccccTTcccccccTTcccHHHHHHHHHHHHHHHHccTTccccccccEE:Sec Str :============================================================:RP:SCP|305->642|1bhwA|4e-25|14.2|318/392|c.1.15.3 :============================================================:BL:SWS|3->709|AGAL1_PEDPE|e-161|41.2|704/733 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|331->557|PF02065|3e-67|61.3|204/225|Melibiase 541: + . . . . *: 600 :YAPQAWTSDDTDPIERLKIQHGTSYGYSPSMMTAHVSISPNEQSGRQTSLDTRTNVAYFS:Sequence :EcccccTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHTTHHHHTcccccT:Sec Str :============================================================:RP:SCP|305->642|1bhwA|4e-25|14.2|318/392|c.1.15.3 :============================================================:BL:SWS|3->709|AGAL1_PEDPE|e-161|41.2|704/733 :$$$$$$$$$$$$$$$$$ :RP:PFM|331->557|PF02065|3e-67|61.3|204/225|Melibiase 601: . . . . + .: 660 :SFGYELDVTRLSVEEKEQVREQIQFYKKYRSLFQYGDFYRINSPFSCDSASWQVVSKDKC:Sequence :TccHGGGTTcTTcHHHHHcTTTTTTccHHHHTTccccHHHHHHHHEEETTEEEEEEccTT:Sec Str :========================================== :RP:SCP|305->642|1bhwA|4e-25|14.2|318/392|c.1.15.3 :============================================================:BL:SWS|3->709|AGAL1_PEDPE|e-161|41.2|704/733 661: . . . * . .: 720 :QSILLYAQLNSKLNPGYTRVYFSGLDKDKCYSVSRFDEFFYGDELMNAGIKVSLSNLALC:Sequence :TcEEEEEEcccTTcccEE :Sec Str :================================================= :BL:SWS|3->709|AGAL1_PEDPE|e-161|41.2|704/733 721: . . + . . .: 780 :VPEYLTKLFVIEEVVCKY :Sequence : :Sec Str