[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF54982.1 spne4 ACF54982.1 "conserved hypothetical protein"
MSFYGLFYNGIAITPNTYLSAWFVNFIAALPLNFLIVEPIARFILSSFQKPFTGEEVEEV
EDF
//