[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF55041.1"

            "iron ABC transporter, iron-binding protein"
            ""

OrgPattern -------------------------------------1111-------------1211111------- -------------------------1----------------------------------------------------1-------------------------------------------------------------------------------------------------------------------2222222212222222-----222-------------11-11111111111111-11----------------------------1111111---11111-1----1111111111111---------------1111111112-3------1211-2---------2---------1--------------------------11111111111--------------33-11--111-------1-----2-----------------------------------------------------11---1111111111111111111-1111--1--------1------2-----------------------------------------------------------------------------------------------------------------------------1-1--2--11--------1-----1---1-----------11112--------------------------1-----------------------------222443--1-11224-----------1-------1----------------------111111---11-----------------6--------------1---------------------------1--1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKKWMYYAACSSNESADDSSSDKGDGGSLVVYSPNSEGLIGATIPAFEEKYGIKIELIQ:Sequence : EEEEEcccHHHHHHHHHHHHHHHcccEEEEE:Sec Str : XXXXXXXXXXXXXXXXXXXXX :SEG|9->29|aacssnesaddsssdkgdggs : ===============================:RP:SCP|30->193|1q35A|3e-28|25.9|158/317|c.94.1.1 : ===============================:BL:SWS|30->193|Y131_HAEIN|2e-17|36.3|157/346 61: . . . * . .: 120 :AGTGELFKKLESEKEVPVADVIFGGSYTQYATHGELFENYISKENDNVIKEYQNTTGFST:Sequence :ccHHHHHHHHHHHGGGccccEEEEccGGGHHHHHHccccccHHHHHTTccTTccTTcccE:Sec Str :============================================================:RP:SCP|30->193|1q35A|3e-28|25.9|158/317|c.94.1.1 :============================================================:BL:SWS|30->193|Y131_HAEIN|2e-17|36.3|157/346 121: . . + . . .: 180 :PYTLDGSVLIVHPDLTKGMNIEGYSDLLKPELKGKIATADPANSSSAFAQLTNMLQAQGG:Sequence :EEEEEEEEEEEETTccGGGccccGGGGGcGGGTTcEEEEEcTTcHHHHHHHHHHHHHHcH:Sec Str :============================================================:RP:SCP|30->193|1q35A|3e-28|25.9|158/317|c.94.1.1 :============================================================:BL:SWS|30->193|Y131_HAEIN|2e-17|36.3|157/346 181: . * . . . .: 240 :YKDDKAWSYVKDLFTLIDGIVK :Sequence :HHHHHHHHHHHHHEEEcccHHH :Sec Str :============= :RP:SCP|30->193|1q35A|3e-28|25.9|158/317|c.94.1.1 :============= :BL:SWS|30->193|Y131_HAEIN|2e-17|36.3|157/346