[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF55041.1 spne4 ACF55041.1 "iron ABC transporter, iron-binding protein"
MKKKWMYYAACSSNESADDSSSDKGDGGSLVVYSPNSEGLIGATIPAFEEKYGIKIELIQ
AGTGELFKKLESEKEVPVADVIFGGSYTQYATHGELFENYISKENDNVIKEYQNTTGFST
PYTLDGSVLIVHPDLTKGMNIEGYSDLLKPELKGKIATADPANSSSAFAQLTNMLQAQGG
YKDDKAWSYVKDLFTLIDGIVK
//