[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF55075.1"

            "RRF2 family protein"
            ""

OrgPattern -------------------------------------------------------------------- 1-----------------------------------------------------------------1-1-------11---2-------------------1-----1------------------------------------1--------------------------------------21-----1--2333332331333333112221332-1-1-1-11111122---------------1----1-32--23--122----11-111----------1--11111111111-------------133111333------1111111-1-------------------11-----------------1------------------1--1------------1-----1------------111-1------1--------------------11----------------------------------1-------1111121111111111111111111112----1-----1-----------------------------------------------------1-11---11---------1---------------------------------1--------------------------1--------------------------------------11------------------------------------------------------1------------------------------------1--------------------------------------------------2--1111--------2--------------------1-----------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQIPSRFTIATHMLIIIALEGKESKVTSDFLAASVGVNPVIIRKILSQLKKAELISVARG:Sequence : ccccHHHHHHHHHHHHHHTcTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEcc:Sec Str : =================================================:RP:SCP|12->102|1f6vA|2e-09|11.5|78/91|a.49.1.1 : ==========================================================:BL:SWS|3->136|YWNA_BACSU|9e-28|46.1|128/133 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->82|PF02082|3e-09|35.4|82/83|Rrf2 61: . . . * . .: 120 :TGGTEIVKDLKDISLLDVYQAVECLGKTGQLFSFHDNPNPNCPVGAHIHDVLDQKLERIQ:Sequence :ccccEEcccGGGccHHHHHHHHcccH cccccHHHHHHHHHHHHHHHHHH:Sec Str :========================================== :RP:SCP|12->102|1f6vA|2e-09|11.5|78/91|a.49.1.1 :============================================================:BL:SWS|3->136|YWNA_BACSU|9e-28|46.1|128/133 :$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|1->82|PF02082|3e-09|35.4|82/83|Rrf2 121: . . + . . .: 180 :LTMEAELGQTSLEKVVADAESQMKD :Sequence :HHHHHHHTTccHHHHc :Sec Str :================ :BL:SWS|3->136|YWNA_BACSU|9e-28|46.1|128/133