[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF55075.1 spne4 ACF55075.1 "RRF2 family protein"
MQIPSRFTIATHMLIIIALEGKESKVTSDFLAASVGVNPVIIRKILSQLKKAELISVARG
TGGTEIVKDLKDISLLDVYQAVECLGKTGQLFSFHDNPNPNCPVGAHIHDVLDQKLERIQ
LTMEAELGQTSLEKVVADAESQMKD
//