[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF55169.1"

            "Pyruvate dehydrogenase complex E2 component, dihydrolipoamide acyltransferase, putative"
            ""

OrgPattern 11------1111111---111---2111--11----------------------------1111---- 1223522222223242333-322243333333444435764444344433335564452244434374644-----------3---1-111--1--22233334333333333333333333332---1----12-34433---221111111111111111111111111111111111111333331--324444444443444444474454444455344322222242233333333333333344432-1-22-1---111111111111111111111112211111-111111111111111111211111111111---1111111-1--111---------3--------------11311-13-2422222222224223222222244444433443-225225232422233232533344223233242222232222222222222222222222222222222222222222222222235831232233443443333322243333243332323233332222222444222221112322222222223322-1-2----------323133421333333-21---------------------112223223323343434333343333333333441-2432222222232222222222233322-222223322223222222323322232222222222222222222222222222222222222222223333333333223232222222222222223333323222324444333333333222222222222211223222223323333222222222222111-222221----------111111-1-11111111211111-------------222 33--444-833-3333332343344433333333333423333333223444443333333332222222222222222222222222-23232222222233545-34474666554443244464739c4-64B2422524644444444263953449F37341434A54554434w434458AFC3B55584574 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MADDKLRATPAARKLADDLGINLYDVSGSGANGRVHKEDVETYKDTNVVRISPLAKRIAL:Sequence : cccccccccHHHHHHHHTTccTTTcccccccccccHHHHHTTHcHHHcccccHHHHHHH:Sec Str : ========================================== :RP:SCP|2->43|1balA|8e-12|28.6|42/51|a.9.1.1 : ============:RP:SCP|49->87|1balA|3e-09|35.9|39/51|a.9.1.1 : ======================================= :BL:SWS|5->43|ODB2_BOVIN|2e-05|51.3|39/482 : ========================:BL:SWS|37->347|ODP2_RICFE|2e-56|41.0|293/412 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|5->40|PF02817|2e-06|52.8|36/39|E3_binding 61: . . . * . .: 120 :EHNIAWQEIQGTGHRGKIMKKDVLALLPENIENDSIKSPAQIEKVEEVPDNVTPYGKIER:Sequence :HTTccTTTcccccccccccHHHHHcTcHHHHTcccccccc cccccccTTcccccc:Sec Str :=========================== :RP:SCP|49->87|1balA|3e-09|35.9|39/51|a.9.1.1 :============================================================:BL:SWS|37->347|ODP2_RICFE|2e-56|41.0|293/412 : $$$$$:RP:PFM|116->347|PF00198|6e-60|51.1|231/232|2-oxoacid_dh 121: . . + . . .: 180 :IPMTPMRKVIAQRMVESYLTAPTFTLNYEVDMTEMLALRKKVLEPIMEATGKKTTVTDLL:Sequence :ccccccccHHHHHHHHHHHcccEEEEEEEEEcHHHHHHHHHHHHHHHHHHccccccHHHH:Sec Str : ==========================================================:RP:SCP|123->346|1c4tA|8e-76|36.5|222/226|c.43.1.1 :============================================================:BL:SWS|37->347|ODP2_RICFE|2e-56|41.0|293/412 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|116->347|PF00198|6e-60|51.1|231/232|2-oxoacid_dh 181: . * . . . .: 240 :SLAVVKTLMKHPYINASLTEDGKTIITHNYVNLAMAVGMDNGLMTPVVYNAEKMSLSELV:Sequence :HHHHHHHHHHcHHHHcEEcTETTEEEccccccEEEcEEETTEEEccEEccTTTccHHHHH:Sec Str :============================================================:RP:SCP|123->346|1c4tA|8e-76|36.5|222/226|c.43.1.1 :============================================================:BL:SWS|37->347|ODP2_RICFE|2e-56|41.0|293/412 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|116->347|PF00198|6e-60|51.1|231/232|2-oxoacid_dh 241: + . . . . *: 300 :VAFKDVIGRTLDGKLAPSELQNSTFTISNLGMFGVQSFGPIINQPNSAILGVSSTIEKPV:Sequence :HHHHHHHHHHHTTcccTTTTccccEEEEEcGGGTcccccccccTTccEEEEEcccEEEEE:Sec Str :============================================================:RP:SCP|123->346|1c4tA|8e-76|36.5|222/226|c.43.1.1 :============================================================:BL:SWS|37->347|ODP2_RICFE|2e-56|41.0|293/412 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|116->347|PF00198|6e-60|51.1|231/232|2-oxoacid_dh 301: . . . . + .: 360 :VVNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKELIETPISMLI :Sequence :EETTEEEEEEEEEEEEEEETTTccHHHHHHHHHHHHHHHTcGGGTcc :Sec Str :============================================== :RP:SCP|123->346|1c4tA|8e-76|36.5|222/226|c.43.1.1 :=============================================== :BL:SWS|37->347|ODP2_RICFE|2e-56|41.0|293/412 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|116->347|PF00198|6e-60|51.1|231/232|2-oxoacid_dh