[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF55177.1"

            "choline-binding protein F, point mutation"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------32222222231--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKLLKKMMQVALATFFFGLLGTSTVFADDSEGWQFVQENGRTYYKKGDLKETYWRVIDGK:Sequence : ccEEEEEcccccEEEEETTEEEEEETTEEEEcEEEETTE:Sec Str : =============================:RP:SCP|32->111|2bibA1|6e-07|24.1|79/232|b.109.1.1 : =============================================:BL:SWS|16->133|TOXA_CLODI|2e-08|34.5|116/2710 61: . . . * . .: 120 :YYYFDPLSGEMVVGWQYIPAPHKGVTIGPSPRIEISLRPDWFYFGQDGVLQEFVGKQVLE:Sequence :EEEcTTTccccccEEEEEEcccccTTETTcccccccccEEEEEEcTTccccccccEEEEE:Sec Str :=================================================== :RP:SCP|32->111|2bibA1|6e-07|24.1|79/232|b.109.1.1 :============================================================:BL:SWS|16->133|TOXA_CLODI|2e-08|34.5|116/2710 121: . . + . . .: 180 :AKTATNTNKHHGEEYDSPAEK :Sequence :ccccTTccccTTccccccccE :Sec Str :============= :BL:SWS|16->133|TOXA_CLODI|2e-08|34.5|116/2710