[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF55177.1 spne4 ACF55177.1 "choline-binding protein F, point mutation"
MKLLKKMMQVALATFFFGLLGTSTVFADDSEGWQFVQENGRTYYKKGDLKETYWRVIDGK
YYYFDPLSGEMVVGWQYIPAPHKGVTIGPSPRIEISLRPDWFYFGQDGVLQEFVGKQVLE
AKTATNTNKHHGEEYDSPAEK
//