[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF55178.1"

            "serine/threonine protein kinase"
            ""

OrgPattern -------------1---111111----8---1-----------31-13-------1-6---1------ 4U*4c33333333358999-9A33MC99999AACCDI6YO3hQr34435545558434226773LCGSPNH555534422247-------2--1--3--------1-111211111122222222--------2--B99IK---R2N7BH2286633------324APQSI------------65544112112111111111111111111111111111111122223231111111-1111111111111111111111111111111-11111111111111111111111111111111111111111111111111121122111111113111112111113111131111122111211111--1T-k1---------4311---21111------------11-1-1-1-1-----21---2---31-4----1-11--1--------1----6---------------------------------1-------2411112-1111--331111111113121-1--1652111222312252232------------3851A5631-1-11111----2----1HHJH**-3-----------------------11----12183-3-2-1---1211111-111-23------2---------------------2-----------1--------1-------------------1-1---------------------------3---------11B11----------------------1211522232112311223111----------1122------1131--2-3--111----111-112222---------------1-111-111---111111--------------55 LILP***3*y*cv**bddWbijefifbbZWaDXYfZZgaeZcffWaXagegcitZceSXecfggebccHZiidXdlnRkpedefadoi-o*sdiqriWehccX***A*************************S*********************************p********I**Z*ZTV*n****b**Yr***** --------------------------------------------------------------------------------------------------------------------------------------------------------------------------3----

Master   AminoSeq   


1: . . . . + .: 60 :MGQILLAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLGSV:Sequence :HHHHTTcccGGGcEEEEcccccGGGEEEcccEEEcccTTcEEEEHHHHHHHHHcHGGGEE:Sec Str : ############# :PROS|16->28|PS00108|PROTEIN_KINASE_ST|PDOC00100| :============================================================:RP:SCP|1->143|1nw1A|3e-23|5.7|140/365|d.144.1.8 : ==========================================================:BL:SWS|3->388|PKNB_LACLA|8e-82|45.1|381/627 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->125|PF00069|1e-22|41.0|122/256|Pkinase 61: . . . * . .: 120 :HYLSPEQARGSKATVQSDIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQKPLPSVIAEN:Sequence :cccccTTccEEcGGGcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccHH:Sec Str :============================================================:RP:SCP|1->143|1nw1A|3e-23|5.7|140/365|d.144.1.8 :============================================================:BL:SWS|3->388|PKNB_LACLA|8e-82|45.1|381/627 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->125|PF00069|1e-22|41.0|122/256|Pkinase 121: . . + . . .: 180 :PSVPQALENVIIKATAKKLTNRYRSVSEMYVDLSSSLSYNRRNESKLIFDETSKADTKTL:Sequence :HHHHHHHHHHccccHHHHHHHHHHHHHHHTHHHcHHHHHTTccccccccccccTTccTTc:Sec Str :======================= :RP:SCP|1->143|1nw1A|3e-23|5.7|140/365|d.144.1.8 :============================================================:BL:SWS|3->388|PKNB_LACLA|8e-82|45.1|381/627 :$$$$$ :RP:PFM|3->125|PF00069|1e-22|41.0|122/256|Pkinase 181: . * . . . .: 240 :PKVSQSTLTSIPKVQAQTEHKSIKNPSQAVTEETYQPQAPKKHRFKMRYLILLASLVLVA:Sequence :ccccccccccccccccTGG :Sec Str : XXXXXXXXXXX:SEG|230->244|lillaslvlvaasli :============================================================:BL:SWS|3->388|PKNB_LACLA|8e-82|45.1|381/627 241: + . . . . *: 300 :ASLIWILSRTPATIAIPDVAGQTVAEAKATLKKANFEIGEEKTEASEKVEEGRIIRTDPG:Sequence : :Sec Str :XXXX :SEG|230->244|lillaslvlvaasli : XXXXXXXXXXXX :SEG|280->291|eekteasekvee : ===================================================:RP:SCP|250->316|1k25A1|2e-09|16.7|60/61|d.11.1.1 :============================================================:BL:SWS|3->388|PKNB_LACLA|8e-82|45.1|381/627 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|256->316|PF03793|5e-05|40.0|60/63|PASTA 301: . . . . + .: 360 :AGTGRKEGTKINLVVSSGKQSFQISNYVGRKSSDVIAELKEKKVPDNLIKIEEEESNESE:Sequence : :Sec Str : XXXXXXXXX:SEG|352->360|eeeesnese :================ :RP:SCP|250->316|1k25A1|2e-09|16.7|60/61|d.11.1.1 :============================================================:BL:SWS|3->388|PKNB_LACLA|8e-82|45.1|381/627 :$$$$$$$$$$$$$$$$ :RP:PFM|256->316|PF03793|5e-05|40.0|60/63|PASTA 361: . . . * . .: 420 :AGTVLKQSLPEGTTYDLSKATQIVLTVAKKATTIQLGNYIGRNSTEVISELKQKKVPENL:Sequence : :Sec Str :============================ :BL:SWS|3->388|PKNB_LACLA|8e-82|45.1|381/627 421: . . + . . .: 480 :IKIEEEESSESEPGTIMKQSPGAGTTYDVSKPTQIVLTVAKKVTSVAMPSYIGSSLEFTK:Sequence : :Sec Str : XXXXXXXXX :SEG|424->432|eeeessese 481: . * . . . .: 540 :NNLIQIVGIKEANIEVVEVTTAPAGSAEGMVVEQSPRAGEKVDLNKTRVKISIYKPKTTS:Sequence : :Sec Str 541: + . . . . *: 600 :ATP :Sequence : :Sec Str