[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF55191.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFKNFNNIWLKRKIVLLLRIVLMMILINHLLSTAVQKQDAVIFFKRELISIFSYNDYSEA:Sequence : XXXXXXXXXXXXXXXXXX :SEG|10->27|lkrkivlllrivlmmili 61: . . . * . .: 120 :NLEIPKLLLNLSLFMVGWLSVILLESDLADHYHHLIRYQSSSFFDYTRKRLVVISKFFTQ:Sequence 121: . . + . . .: 180 :DLFVWFLGLLPLGIHFKTVALFFLLAQLMMLYLLLSYLIALISAGAGFSFFLYFLAFVGQ:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXX :SEG|140->164|alffllaqlmmlylllsylialisa 181: . * . . . .: 240 :EWMMDHIVTVYLVLLSLLVMLILSRLEEKFKKG :Sequence : XXXXXXXXXXXXXXXXXXX :SEG|188->206|vtvylvllsllvmlilsrl